KEGG   Pseudomonas brassicacearum: PSEBR_a1900Help
Entry
PSEBR_a1900       CDS       T01472                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pba  Pseudomonas brassicacearum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pba00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2319027..2321261
Genome map
AA seq 744 aa AA seqDB search
MSVSNKEPQGQAKESLLPAPHDIDALVRAEHHDPFSILGPHGDDAGGQFIRAYLPGALSV
HVLARDGGEELGELQSTATPGLFVGHFDRTQAYLLRTRWAGGEQVAEDPYSFGPLLGEMD
LYLFGEGNHRDLSSCLGAQLTTVDGIDGVRFAVWAPNARRVSVVGDFNVWDGRRHPMRIR
YPSGVWEIFIPRLGPGEGYKYEILGAHGILPLKADPVALATQMPPDTASRVASPLKIEWQ
DDEWMQHRRERHLPGAPLSIYELHAGSWQCEIDEAGEVARQYNWHEMAERLIPYVKDLGF
THIELMPIMEHPFGGSWGYQPLSQFAPTARFGSPDDFAAFVNACHQANIGVILDWVPAHF
PTDTHGLAQFDGTALYEYGNPLEGFHQDWDTLIYNLGRTEVHGFMLASALHWLKHFHVDG
LRVDAVASMLYRDYSRKAGEWVPNRHGGRENLEAIDFLRHLNDVVALETPGALVIAEEST
AWPGVSQSTQQGGLGFAYKWNMGWMHDSLHYIQQDPVYRAHHHNELSFGLVYAWSERFVL
PISHDEVVHGKRSLIDKMPGDRWQKFANLRAYLSFMWGHPGKKLLFMGCEFGQWREWNHD
QQLDWYLLQYPEHRGVQKLVSDLNRLYREEPALHDQDDAPQGFQWLIGDDALNSVYAWLR
WSKEGRPVLVVANFTPVPREAYRVGVPFGGRWVELLNSDADTYAGSNYGNGGGASTEEVP
SHGQALSLELNLPPLAVLILRPEG
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtctcgaacaaagaaccacaggggcaggccaaagagtcgttgctgccggcgccc
catgacatcgacgcgctggtgcgcgccgaacaccacgacccgttttccatcctggggcct
catggcgacgacgccggcggccaattcattcgcgcgtatctgcccggagccctgagcgtg
catgtgctggcccgcgatggcggcgaagagctgggggagctgcaatccaccgcaaccccg
ggactgttcgtcggccatttcgaccgtacccaggcgtacttgctgcgcacccgttgggcc
ggcggcgagcaggttgccgaagacccctacagcttcggcccgttgctgggggagatggac
ctttacctgtttggcgagggcaatcaccgcgacctcagttcctgcctcggtgcgcaactg
accaccgtcgatggcatcgacggcgtgcggttcgctgtctgggcgccgaacgcccgacgc
gtttcggtggtcggggatttcaacgtctgggacgggcgtcggcatccgatgcgcatccgt
tatccgtccggcgtgtgggagatattcatccccaggctgggtcccggcgaaggttacaag
tatgaaatcctcggcgcccacggcatcctgccgctcaaggccgacccggtggccctggcc
acgcagatgccgccagacacggcgtcgagagtcgcctcacccctgaagatcgagtggcag
gacgacgagtggatgcagcaccgtcgcgagcggcatctcccgggtgcgccgctgtcgatc
tatgaattgcacgccggctcctggcagtgcgaaatcgacgaggcgggtgaggtggcccgg
cagtacaactggcatgaaatggccgagcggctgatcccgtatgtcaaggacctgggcttc
acccacatcgagctgatgccgatcatggagcacccgttcggcggctcctggggctatcag
ccgctgtcgcaattcgcgccgacggcacgcttcggctcgccggacgatttcgcggcgttc
gtcaacgcctgccaccaggccaatatcggcgtcatcctcgactgggtgccggcgcatttt
cccaccgacacccacggcctggcccagttcgacggcactgcgctgtacgaatacggcaac
ccgctggaaggcttccaccaggattgggacacgctgatctacaacctgggccgcaccgaa
gtgcacggtttcatgctggcgtcggcgctgcactggctcaagcatttccacgtcgatggc
ctgcgggtggatgccgtggcctcgatgttgtaccgcgactattcgcgcaaggccggcgag
tgggtgcccaaccgccacggcggacgggaaaacctcgaagccatcgatttcctgcggcac
ctcaacgatgtggtggcgctggaaacccccggtgcgctggtcatcgccgaagaatccacg
gcgtggccgggcgtcagccagagcacccagcagggcggcctgggtttcgcctacaagtgg
aacatgggctggatgcacgattcgctgcactacatccagcaagacccggtgtaccgcgcc
catcaccacaacgaactgagcttcggcctggtgtatgcctggtccgagcgcttcgtcctg
ccgatttcccatgacgaagtggtccacggcaaacgctcgctgatcgacaagatgcccggt
gaccgctggcagaaattcgccaacctgagggcctacctcagcttcatgtgggggcatccc
ggcaagaagctgttgttcatgggctgtgaattcggccaatggcgcgagtggaaccacgac
cagcagttggactggtacctgctgcaataccctgagcaccgtggtgtgcagaaactggtc
agcgatctgaaccgtctgtatcgcgaagaaccggcgctgcacgaccaggatgatgcgccc
caggggttccagtggttgattggcgacgatgcgcttaacagcgtctacgcctggctgcgc
tggagcaaggagggccggccggtgctggtggtcgccaacttcacgccggtgccgcgcgag
gcctaccgggtcggcgtgccattcggcgggcgctgggtcgaattgctcaacagcgatgcc
gacacctacgccggttccaactatggcaatggcggtggagcctccaccgaagaggtgccc
agccatggccaggccctgtcgctggaactcaacttgccgccgttggcggttttgatcctg
cggccggagggttag

DBGET integrated database retrieval system