KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a1955Help
Entry
PSEBR_a1955       CDS       T01472                                 

Definition
magnesium chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pba00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PSEBR_a1955
Enzymes [BR:pba01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     PSEBR_a1955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2386778..2387776
Genome map
AA seq 332 aa AA seqDB search
MTHTPHFPLCAVVGADDLKLALCLAAIDPKIGGVLIEGPRGMAKSTLARGLADLLASGQF
VTLPLGATEERLVGTLDLDAALGEGRAQFSPGVLAKADGGVLYVDEVNLLPDHLVDLLLD
VAASGINLIERDGISHRHPARFVLIGTMNPEEGELRPQLLDRFGLNVALDGHTAPTERGQ
IIRRRLDFDSDPQAFCAAWETTQAQLRERCQQARDRLAGIALDDAALAQITERCFAAGVD
GLRADLVWLRAARAHAAWRGAAAIADEDIDAVAEFALRHRRRGHSAPTPSQAPTGAEKTT
EPSEGQGQWGDLPARALPTGARRDVPSWPKKP
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgacccacaccccccatttcccgctctgcgccgtggtcggcgccgatgatctgaaactg
gccctgtgcctggccgcgatcgatccgaaaatcggcggtgtgctgatcgaagggccgcgg
ggcatggccaagtccacactggcccggggcctggcggacctgctggccagcggtcagttc
gtcaccttgcccctcggtgctaccgaagagcgactggtgggcaccctggacctggacgcg
gcgctgggggaagggcgcgcgcagttttctcccggcgtgttggccaaggccgatggtggc
gtgctgtacgtcgatgaagtgaacctgctgcccgatcacctggtggacttgctgctcgat
gtggccgccagcggcatcaacctcatcgagcgcgacggcatttcccatcggcatccggcg
cgctttgtgctgatcggcaccatgaatccggaagagggcgaactgcgcccgcagttgctc
gaccgttttggcctgaacgtcgccctcgacggtcacaccgcaccgactgagcgcggccag
atcatccgacggcggctggatttcgacagcgatccgcaggcgttctgcgcggcgtgggag
acgacccaggcgcagttgcgcgaacgttgccaacaggcacgcgaccgcttggccgggatc
gccctggatgacgcggcgctggcgcagatcaccgagcgctgctttgccgccggggtcgat
ggcttgcgcgccgacctggtctggctgcgggcggcccgggcccatgcggcttggcgcggg
gctgctgcaattgccgatgaagacatcgatgcggtcgccgagtttgccttgcggcaccgg
cggcgcgggcattcggcaccgacaccgtcccaggcgccgaccggcgcggaaaaaaccact
gaacccagcgagggccagggccagtggggtgacctgccggcccgggcattgccgaccggt
gctcggcgtgacgtgccgagctggccaaaaaagccctag

DBGET integrated database retrieval system