KEGG   Pseudomonas brassicacearum: PSEBR_a2099Help
Entry
PSEBR_a2099       CDS       T01472                                 

Definition
nitrous-oxide reductase
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
pba  Pseudomonas brassicacearum
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Module
Denitrification, nitrate => nitrogen
Brite
KEGG Orthology (KO) [BR:pba00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    PSEBR_a2099
Enzymes [BR:pba01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     PSEBR_a2099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2586034..2587971
Genome map
AA seq 645 aa AA seqDB search
MTDNKTNADHEPKEATQEFKSPGLSRRGFLGTSALASASLAGASALGSVVFTRESWAAAA
KDAQSKIHVAPGELDQYYGFWSGGHQGEVRIMGVPSMRELLRIPVFNVDSATGWGLTNES
KRILGDSARFMNGDCHHPHLSMTDGKYDGKYLFINDKANSRIARIRLDIMKCDKMLTVPN
VQAIHGLRLQKVPHTQYVFANAEFVIPHPNDGSTFDLQDKNSFTMFNAVDAEKMEMAFQV
IVDGNLDNTDADYTGKYAASTCYNSEKAYDLGGMMRNERDWVVVFNIPRIEAAIKAGKFI
TLDGSKVPVVDGRKSDGKDSEFTRYIPVPKNPHGLNTSPDGKYFIANGKLSPTCTIIATA
KLDDLFDDKLKDPRDVVVGEPELGLGPLHTTFDGRGNAYTTLFIDSQVVKWNMEEAIRAY
KGEKVNYIKQKLDVQYQPGHNHASLTETREADGQWLVVLSKFSKDRFLSTGPLHPENDQL
IDISGDEMKLVHDGPAFAEPHDCVMARRDQIKTKKIWDRNDPFFAETVAIAAKDGIKLET
DNKVVREGTKVRVYMTSMAPAYGMQEFTVKQGDEVTVTITNIDKIEDVSHGFVMTNHGVS
MEISPQQTSSITFIADKPGLHWYYCSWFCHALHMEMVGRMKVERV
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgactgacaacaaaacgaatgctgatcatgaacctaaggaggcaacgcaggaatttaaa
tcgcccggccttagccgtcgcggttttctcggtaccagtgcgcttgccagcgcttcgcta
gccggtgcatcggcacttggcagcgtggtcttcacccgcgaatcctgggcggctgcggct
aaggatgcgcagtcgaaaattcacgtggcgccgggtgaactggaccagtattacggtttc
tggagcggcggccatcagggcgaagtgcggatcatgggggttccatcgatgcgcgagttg
ttacgcataccggtattcaacgtcgactctgccaccggttgggggctgaccaacgaaagc
aagcggatactgggtgatagcgcaagattcatgaatggcgattgccaccatccacacttg
tccatgactgacggtaagtacgacggcaagtacctgttcatcaatgacaaggccaactcc
cggatcgcgcgcattcgcctagacattatgaagtgcgacaagatgcttactgtgcccaac
gtacaggcgatccatggcctacggctgcaaaaggtgccccatactcagtatgtgttcgcc
aacgctgagttcgttattccgcatcccaacgacggtagcaccttcgacttgcaggataag
aacagcttcacaatgttcaacgctgtcgatgccgagaaaatggagatggccttccaggtg
atcgtcgacggcaacctggacaacaccgacgctgactacaccggcaaatacgccgccagc
acctgctacaactccgagaaggcctacgacctgggcggtatgatgcgcaacgagcgcgac
tgggtggtggtgttcaacatccctcgcatcgaagcggcgatcaaggccggcaagttcatc
accctggacggttctaaggtccctgtggtggatgggcgcaaaagcgacggcaaggattct
gaatttacccgctatatccctgtgccgaaaaatcctcatgggctcaatacctcgcctgac
ggcaaatatttcatcgccaacggcaagctctcgcctacatgcacaatcattgcaactgcc
aagctcgacgatttatttgatgacaagctcaaagacccacgggacgtggtagtcggtgag
cctgaactgggactggggccgttgcacaccaccttcgacggccgcggtaacgcctatacc
accttgtttatcgatagccaggtagtgaaatggaacatggaagaggcgatccgcgcctac
aagggagagaaggtcaactacattaagcaaaaactcgacgtgcagtaccaacccggacat
aaccacgcgtcgctgaccgaaacccgtgaggccgacggccagtggctggtggtactcagc
aagttttccaaggatcgctttctgtcgaccggtccgctgcacccggaaaacgaccagttg
atcgatatttccggtgacgagatgaagctggtgcacgacggcccggccttcgctgaacca
catgactgcgtcatggcccgtcgagatcagatcaagactaaaaagatctgggaccgcaac
gatccgttttttgcagaaaccgtggctatcgctgcgaaggacggaattaaactggagact
gataacaaggttgtccgagagggcacgaaagttcgtgtctatatgacttctatggcccct
gcctatggaatgcaagaatttaccgtaaaacaaggcgatgaggttactgtgacgataact
aatatcgataagattgaggatgtctctcacggctttgtcatgactaatcatggtgtaagt
atggagattagcccgcaacaaacatcgtcgataactttcattgctgacaagcccggtctg
cattggtactactgcagttggttctgtcatgcactgcacatggaaatggttgggcgtatg
aaagtcgagcgagtttaa

DBGET integrated database retrieval system