KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a2804Help
Entry
PSEBR_a2804       CDS       T01472                                 

Definition
(GenBank) putative enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Pathway
pba00071  Fatty acid degradation
pba00280  Valine, leucine and isoleucine degradation
pba00281  Geraniol degradation
pba00310  Lysine degradation
pba00360  Phenylalanine metabolism
pba00362  Benzoate degradation
pba00380  Tryptophan metabolism
pba00410  beta-Alanine metabolism
pba00627  Aminobenzoate degradation
pba00640  Propanoate metabolism
pba00650  Butanoate metabolism
pba00903  Limonene and pinene degradation
pba00930  Caprolactam degradation
pba01100  Metabolic pathways
pba01110  Biosynthesis of secondary metabolites
pba01120  Microbial metabolism in diverse environments
pba01130  Biosynthesis of antibiotics
pba01212  Fatty acid metabolism
Module
pba_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pba00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PSEBR_a2804
   00650 Butanoate metabolism
    PSEBR_a2804
  Lipid metabolism
   00071 Fatty acid degradation
    PSEBR_a2804
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSEBR_a2804
   00310 Lysine degradation
    PSEBR_a2804
   00360 Phenylalanine metabolism
    PSEBR_a2804
   00380 Tryptophan metabolism
    PSEBR_a2804
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PSEBR_a2804
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PSEBR_a2804
   00281 Geraniol degradation
    PSEBR_a2804
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PSEBR_a2804
   00627 Aminobenzoate degradation
    PSEBR_a2804
   00930 Caprolactam degradation
    PSEBR_a2804
Enzymes [BR:pba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PSEBR_a2804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEA69103
UniProt: F2KG47
Position
3472863..3473675
Genome map
AA seq 270 aa AA seqDB search
MSQYQAFNVELADNIAHVQINRPEKINSMNAAFWSEIIEIFQWIDDTDAARVVVLSGAGK
HFSSGIDLMMLAGVANELGKDVGRNARLLRRKILQLQASFNAVDNCRKPVLAAIQGYCLG
GAIDLIAACDMRYAAEDAQFSIKEIDIGMAADVGTLQRLPRIIGDGMLRELAYTGRTFGA
DEARSIGLVNRVYSDTASLLDGVMGIAREIAAKSPIAVTGTKEMISYMRDHRIDDGLEYV
ATWNAAMLQSTDLRVAMAAHMSKQKPEFQD
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaataccaagcgttcaacgtcgaacttgcagacaacattgcccatgtgcagatc
aatcgcccggaaaagatcaactcgatgaacgctgcgttctggagcgagatcatcgagatc
ttccagtggatcgacgacaccgatgccgcacgggtggtggtgctgagcggtgccggcaag
catttctcctcggggatagacctgatgatgctggcgggcgtggccaacgagttgggcaag
gacgtagggcgcaatgcacgcctgctgcggcgcaagatcctgcaactgcaagcctcgttc
aacgccgtggacaactgccgcaaacccgtgctcgcggctatccagggctattgcctgggc
ggggccatcgacctgattgccgcctgcgacatgcgttacgcggccgaggacgcccagttc
tccatcaaggagatcgatatcggcatggccgccgatgttggcacattgcaacgcttgccc
cggatcatcggggacggcatgctgcgtgaactcgcttatacggggcgcacttttggtgcc
gacgaagcgcgcagcatcggcctggtcaatcgtgtctacagtgacaccgccagcctgctc
gacggcgtgatgggcatcgcccgggaaatcgccgccaagtcgccgattgccgtgaccggc
accaaggaaatgatcagctacatgcgcgaccaccgcatcgacgacggtttggaatacgtc
gccacctggaacgccgccatgttgcaatcgaccgacctgcgcgtggccatggccgcccat
atgagcaaacagaaacctgaatttcaggattga

DBGET integrated database retrieval system