KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a2939Help
Entry
PSEBR_a2939       CDS       T01472                                 

Definition
AMP-binding protein
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSEBR_a2939
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSEBR_a2939
   00620 Pyruvate metabolism
    PSEBR_a2939
   00640 Propanoate metabolism
    PSEBR_a2939
  Energy metabolism
   00680 Methane metabolism
    PSEBR_a2939
Enzymes [BR:pba01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PSEBR_a2939
Lipid biosynthesis proteins [BR:pba01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PSEBR_a2939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3623256..3624929)
Genome map
AA seq 557 aa AA seqDB search
MLVMRDYSSATSQFDYLHTVNTALHGSLEALNACVECCDRHALPGRIALFWEGRDGSDAT
WTYRDLQDNAARFANFLRAQGIGKGDKVAGLLPRTAELLIVVLATWRIGAVYQPLFTAFG
PKAIEHRLGSSGARLVVTDAVNRPKLDEVAGCPTIVTVGGEKGQGIVRGDYSFWAEVANH
SSQCEPLMLTGEDPFLLMFTSGTTGPAKALSVPLKAIVAFQNYTRDAVDLRPEDAFWNVA
DPGWAYGIYFGVTGPLAMGHPITFYDGPFTLESTCRVINKYGITNLTGSPTAYRLLIAGG
EQFARSIKGKLRIVSSAGEPLNPEVIRWFADNLNVVIHDHYGQTELGMVLCNHHGLEHPV
HLGAAGFASPGHRIVVLDENQRELGVGQPGILALDRSQSPMCWFAGYEGGPTKAFVGDYY
LSGDTVELNPDGSISFVGRSDDVITTSGYRVGPFDVESALIEHAAVVEAAVIGKPDPERT
ELVKAFVVLSAQYRASAELAEELRQHVRKRLAAHAYPREIEFVSDLPKTPSGKLQRFILR
NQEIAKAQEAAAQNVSA
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgctggtcatgcgcgattattcgtccgccacttcgcagttcgattacctgcacaccgtc
aacactgcactgcacggctcgctcgaggcgctcaatgcctgcgtagagtgttgcgaccgg
catgcgttgccagggcgcatcgccttgttctgggagggtcgtgacggcagcgatgcgact
tggacttaccgtgacctgcaggacaatgccgcgcggttcgccaatttcctgcgcgcccaa
ggcatcggcaagggcgacaaagtggccggtctgttgccgcgcaccgctgaactgctgatc
gtggtgctcgccacctggcgcattggggcagtgtatcaaccgttgttcaccgcattcggg
cccaaggccatcgagcaccgcctcggcagctcgggggcgcgcttggtcgttaccgatgcg
gtcaaccgtcccaagctcgacgaagtcgccggttgtcccaccatcgtcacggtcggcggc
gaaaagggtcagggcatcgtgcgtggcgactacagtttctgggccgaggtggcgaaccac
tccagccagtgcgaaccgctgatgctcaccggcgaagacccgttcctgctgatgttcacc
tccggcaccacaggacctgccaaggcgctgtcggtgccactcaaggccatcgttgcgttc
cagaactacacccgtgacgcggtagacctgcgtcccgaagacgccttctggaacgtcgcc
gacccgggctgggcctacggcatctattttggcgtgaccgggccgctggccatggggcat
ccgattaccttctacgatggcccgttcaccctggaaagcacctgccgggtcatcaacaaa
tacggcatcaccaacctcaccggctcgcccacggcctatcgcctgttgattgccggtggc
gagcagtttgcccgctcgatcaagggcaagctgcgcatcgtcagcagcgccggtgagcca
ttgaacccggaggtgatccgttggttcgccgacaacctgaacgtggtgatccacgaccat
tacggccagaccgaactgggcatggtgctgtgcaaccaccatgggctggaacacccggtg
cacctgggcgcggccggctttgcttcgccaggccatcggatcgtggtgctggatgaaaac
cagcgcgagctgggcgtaggccagccgggcattctcgcactggaccgcagccagtcgccc
atgtgctggttcgccggttacgaaggcgggccgaccaaggccttcgtcggtgactactac
ttgagcggcgataccgtggagctgaacccggacggcagcatcagtttcgtaggccgcagc
gacgacgtgattaccacgtccggctaccgggtcggtccgttcgacgtggaaagcgcgctg
atcgaacacgcggcggtggtggaagcggcggtgatcggcaagcctgatccggaacgcacc
gagctggtgaaggccttcgtggtactcagcgcgcagtaccgtgcctctgcggaactggcc
gaagaattgcgccagcacgtgcgcaagcgcctggcggcccatgcctatccccgtgaaatc
gaatttgtcagcgacttgccgaaaaccccaagcggcaagttgcagcgctttatcttgcgc
aaccaggaaatcgccaaagctcaagaggctgcggctcagaacgtttcagcttga

DBGET integrated database retrieval system