KEGG   Pseudomonas brassicacearum: PSEBR_a300Help
Entry
PSEBR_a300        CDS       T01472                                 

Definition
3,5-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
pba  Pseudomonas brassicacearum
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:pba00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
379565..380392
Genome map
AA seq 275 aa AA seqDB search
MTFPHPLMAPVVELALQAGEAILPFWRANVQVNHKADESPVTAADMAAHDVIVAGLMALA
PDIPILSEEDADIAQSVRAGWHRWWLVDPLDGTKEFISGSEEFTVNIALVEQGRVVFGVV
SMPTNGRFYVGGAGLGAWRGDKGGQPLPIAVRDTLAPGEAFTVVASRRHTSPEQERLLDG
LSGSLGELQLTSIGSSLKFCLVAEGAADCYPRLAPTSQWDTAAAQGVLEGAGGEVLDLSG
EPFCYPPRESLLNTSFLALPAKAAWRGKLLELARS
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgactttccctcatccgttgatggctcctgtggtcgaactggcgctccaggccggtgag
gcgatcctgccgttctggcgcgccaatgtgcaagtcaaccacaaggccgacgagtcgccg
gtgaccgccgcggacatggccgctcatgatgtgatcgtagccgggctgatggcgctggcc
ccggatattccgatcctctccgaagaagacgccgatattgcccaaagcgtgcgcgccggc
tggcatcgctggtggctggtagacccgctggatggcaccaaggaattcatttccggcagc
gaggagttcaccgtcaacatcgcgttggtggagcagggccgtgtggtgttcggcgtggtg
tcgatgcccaccaatgggcgtttttacgtcggcggcgcagggctgggggcctggcgtggc
gacaagggagggcagcccttgccgatcgcggttcgtgacaccctggcgccaggtgaagcc
ttcaccgtggttgccagccgccggcacaccagcccggagcaggaacgcctgctggatggc
ttgagcgggagcctgggtgagctgcaactgaccagtattggcagttcgttgaagttttgc
ctggtggccgaaggcgcggcggattgttatccacggctggcgccgacctcccaatgggac
accgccgccgcccagggtgtattggaaggtgcgggtggcgaggtattggacttgagcggc
gaaccgttctgttacccaccgcgtgagtcgctgttgaatacgtcattcctggcgttgcca
gcgaaagcggcgtggcgtgggaagctgctggagcttgctcgctcttaa

DBGET integrated database retrieval system