KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a3008Help
Entry
PSEBR_a3008       CDS       T01472                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pba00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PSEBR_a3008
Enzymes [BR:pba01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     PSEBR_a3008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3711248..3713326
Genome map
AA seq 692 aa AA seqDB search
MSDAQLEILASRAGLAVDWIDANGRAQKVSPAVLRSVLTGLGHPAGSAQEIDASLLQLQE
AQQNHQLPPLITADVGVSLDLSRYFEAGTPCEIKLEDGATLNLNLDADAKLPGMVPVGYQ
HISIQDQHFTLAVAPARCYSVADAVDDPTPRAWGLSAQLYALRRPGDGGFGDTQALEELA
RVAGERGAEAVAISPMHAMFSSDTGRYSPYSPSSRLFFNSLYAAPGTILGERALRTAIDA
TGLTNQLRTLEEQPLIDWPVAAQAKQKILRALYDGFSLGEHPLHEDFSSFRHTSGEALEN
HCRFEALQAERAARGESLDWRHWPEEWRDPRSPALAHFAEENADEIGFYAFCQWLIARCL
ERAQSAARSSGMGIGLIADLAVGADGGGSQAWSRQDELLASLTVGAPPDILNRSGQGWGI
SAFSPEGLVRNGFRAFIEMLRANFAHAGGLRIDHVMGLQRLWVIPNDAPPCDGAYLYYPV
DDLLRLLALESHRHQAIVLGEDLGTVPDGLRDKLIARSILGMRVLLFEQDNTHFKPILDW
PDNALATTSTHDLPTLNGWWHGHDIDWNARLDLIDSHTEMDWRKHREREREGLRHVLNQD
PQNFREEHRETDQVLDASVRFLGHTRAPLVLLPLEDALGIEEQANLPGTIDTHPNWRRRL
AGQSQALLDHPDAARRLEILACARLQANERDR
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgcgcaactggaaatcctcgccagccgagcgggactggcggtggattggatc
gatgccaatggccgggcccagaaagtctcgccggccgtcttgcgttcggtcctcaccggc
ctgggccatccagccggcagcgcccaggaaatcgacgccagcctgctgcagttgcaggaa
gctcaacagaaccatcaattgccaccgctgatcaccgccgacgtcggggtcagcctggac
ttgagccgctacttcgaggccgggacaccctgcgaaatcaaactcgaagatggcgcgaca
ctgaacctgaacctcgatgccgatgcaaagctgccggggatggtcccggtgggttatcag
cacatcagcatccaggaccagcatttcaccctggccgtcgcgccggcccgttgctacagc
gtggccgatgcggtggacgaccctacgccacgggcctggggcctgagcgcgcaactgtat
gccctgcgccgccccggtgacggtggcttcggtgacacccaggctttggaggagctggcg
cgggtggccggcgagcgcggcgccgaggccgttgccatcagcccgatgcacgcgatgttc
agcagcgacaccgggcgctacagcccctactcaccgtcgagccgactgtttttcaacagc
ctgtacgccgcgccgggaaccatcctcggtgaacgcgcgctgcgcaccgccatcgacgcc
accggcctgaccaatcaactgcgcaccctggaggagcaaccgctgatcgactggccggtc
gctgcccaggccaagcagaagatcctgcgggccctgtacgacggcttcagcctgggtgag
catccgctgcatgaagacttcagcagcttccgccacaccagcggcgaagccctggaaaat
cattgccgcttcgaggccttgcaggccgaacgcgccgcccggggtgaaagcctcgactgg
cgccactggccggaagaatggcgcgacccgcgcagccccgccctggcccatttcgccgag
gaaaatgccgatgagatcggcttctacgctttttgccaatggttgatcgcccgctgcctg
gagcgcgcccagagcgcagccagatccagcggcatgggcatcggtctgatcgccgacctg
gcggtgggtgccgatggcggtggcagccaggcctggagccggcaggacgaactgctcgcc
tcgctgaccgtgggcgccccgccggacattctcaaccgctccggccaaggctgggggatc
tcggcattttccccggaaggcctggtgcgcaacggctttcgcgccttcattgaaatgctg
cgggccaacttcgcccacgccggtggcttgcgcatcgaccatgtcatgggcttgcaacgg
ctctgggtgatccctaacgacgccccaccttgcgatggcgcctacctgtattacccggta
gacgacctgctgcgcctattggcgctcgaatcccatcggcaccaggccatcgtgctcggc
gaagacctcggtaccgtgcccgacggcctgcgggacaaactcattgcccgctcgatcctg
ggcatgcgcgtgctgttgttcgaacaggacaacacccacttcaagcccattctcgactgg
ccggacaatgccctggccaccaccagcacccatgacttgccgacgctcaatggctggtgg
cacggtcacgacatcgactggaacgcccggctggacctgatcgattcccataccgaaatg
gactggcgcaaacaccgcgagcgcgaacgcgaaggcctgcgccacgtgctgaaccaggac
ccgcagaactttcgcgaagaacaccgcgagaccgaccaggtgctcgacgccagcgtgcgc
tttctcggtcacacccgcgcaccgctggtgttgttgccgctcgaagacgccctgggcatc
gaggaacaggccaacctgccgggcaccatcgacacccaccccaattggcgccgccgcctg
gccgggcaaagccaggcgttgctggatcacccggacgctgcccggcgtctggaaatactc
gcctgtgcgagacttcaggcgaacgagcgtgaccgatga

DBGET integrated database retrieval system