KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a3210Help
Entry
PSEBR_a3210       CDS       T01472                                 

Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase, component of acetoin cleaving system
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Pathway
pba00010  Glycolysis / Gluconeogenesis
pba00020  Citrate cycle (TCA cycle)
pba00620  Pyruvate metabolism
pba01100  Metabolic pathways
pba01110  Biosynthesis of secondary metabolites
pba01120  Microbial metabolism in diverse environments
pba01130  Biosynthesis of antibiotics
pba01200  Carbon metabolism
Module
pba_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSEBR_a3210
   00020 Citrate cycle (TCA cycle)
    PSEBR_a3210
   00620 Pyruvate metabolism
    PSEBR_a3210
Enzymes [BR:pba01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PSEBR_a3210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Biotin_lipoyl Thioesterase HlyD_3 Ndr GCV_H PGAP1 Esterase Ser_hydrolase Abhydrolase_8 DUF915 Abhydrolase_5
Motif
Other DBs
NCBI-ProteinID: AEA69520
UniProt: F2K7K9
Position
complement(3954375..3955487)
Genome map
AA seq 370 aa AA seqDB search
MSQIHTLTMPKWGLSMTEGRVDAWLKEEGQAITKGDEVMDVETDKISSSVEAPFSGILRR
QIARQDETLAVGALLGIVVDGDASEAEIDAVIEQFQSTFVPGDAADEDSGPKPQKVELDG
RVIRYFERGEGGTPLLLVHGFGGDLNNWLFNHEALAAGRRVIALDLPGHGESSKTLQRGD
LDELSGVVLALLDHLDINAAHLVGHSMGGAVSLNAARLMPQRVRSLTLIGSAGLGAEING
SYLQGFVEAANRNALKPQLVQLFSNAELVNRQMLDDMLKYKRLEGVDAALQQLSATLFAD
GRQQMDLREVVQAGDVPSLVIWGSDDAIIPAAHSDGLRAQVEVLSGQGHMVQMEAAEQVN
RLILGFIEQH
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgagccagattcataccctgaccatgcccaagtggggcctgtcgatgaccgagggccgg
gtcgatgcctggctcaaggaggagggccaggccatcaccaagggcgatgaagtgatggac
gtggagaccgacaagatctccagcagcgtcgaggcaccgttttccggaatcctgcgccgc
cagatcgcccgccaggacgaaaccctggcggtcggcgccttgctaggcatcgtggtcgac
ggcgatgccagcgaggccgagatcgatgcggtcatcgagcagttccaatcgacctttgtg
cccggcgatgcggccgacgaagacagtggaccgaaaccgcagaaagtcgagttggacggc
cgggtgatccgctatttcgagcggggcgagggcggtacgccgttgttgctggtgcatggt
ttcggcggcgacctgaacaactggctgttcaaccacgaggcgttggcggccgggcgtcga
gtcattgcgctggacctgccgggccatggcgaatcttcgaaaaccctgcagcgcggcgat
ctggacgaattgagcggcgtggtgctggccttgctcgatcacctggacatcaacgccgcg
catctggtggggcattccatgggtggggcggtgtcgcttaacgccgcacgcctgatgccc
cagcgagtccggtcgctgaccttgatcggcagcgccgggctgggcgcggagatcaacggc
agctacctgcaaggttttgtcgaagcggccaaccgcaacgccctcaagccgcaactggtg
caactgttttccaatgccgaactggtcaaccgccagatgctcgacgacatgctcaagtac
aagcgcctggagggcgtggacgcggcgctgcagcaactgtcagcgacgctgttcgccgac
ggccgccaacagatggacttgcgcgaagtggtgcaggccggcgacgtaccgagcctggtg
atctggggcagcgatgacgcaattatcccggcggcccatagcgacgggctgagagcccag
gtggaggtgctgtccggccagggccacatggtgcaaatggaagcggccgagcaggtcaac
cggctgatcctcgggttcatcgagcagcactga

DBGET integrated database retrieval system