KEGG   Pseudomonas brassicacearum: PSEBR_a3416Help
Entry
PSEBR_a3416       CDS       T01472                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pba  Pseudomonas brassicacearum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pba00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PSEBR_a3416
   00052 Galactose metabolism
    PSEBR_a3416
   00500 Starch and sucrose metabolism
    PSEBR_a3416
   00520 Amino sugar and nucleotide sugar metabolism
    PSEBR_a3416
Enzymes [BR:pba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PSEBR_a3416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4220499..4221338)
Genome map
AA seq 279 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYGVEEALDAGLTEISIVTGRGKR
ALEDHFDISYELENQIKGTDKEKYLVGIRKLLDECSFSYTRQTEMKGLGHAILTGRPLIG
DEPFAVVLADDLCVNLEGDGVLTQMVKLYKQFRCSIVAIQEVDPQETNKYGVIAGEMIRD
DIYRVHSMVEKPKPEDAPSNLAIIGRYILTPDIFDLIEQTEPGKGGEIQITDALMKQAQN
GCVMAYKFKGKRFDCGGAEGYIDATNFCFENFYKTGKAY
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagaaatgcttgttcccagcagccggttacggtactcgcttcctgccagcgact
aaagccatgcccaaagaaatgctgccggtggtgaacaagccactgatccagtacggcgtc
gaagaagccctcgatgcgggcctgacggaaatctccatcgtcaccggtcgcggcaaacgc
gccctggaagaccatttcgacatcagctacgagctggaaaaccagatcaagggcaccgac
aaggaaaaatacctggtcggtatccgcaaactgctggatgagtgctcgttctcctacact
cgccagaccgaaatgaaaggcctgggccatgcgatcctgaccggccgcccactgatcggt
gacgaaccgttcgccgtggtcctggcggatgacctgtgcgtcaacctcgaaggcgacggc
gtattgacccagatggtcaagctgtacaagcagttccgctgctccatcgtggcgatccag
gaagtcgatccgcaggaaaccaacaagtacggcgtgattgccggcgaaatgatccgcgac
gacatctaccgcgtccacagcatggttgaaaaaccaaaacctgaagacgcaccgtcgaac
ctggcgatcatcggtcgctacatcctgaccccagatatcttcgacctgatcgaacagacc
gagccaggcaagggcggcgagatccagatcaccgacgccctgatgaaacaggcccagaac
ggctgcgtcatggcctacaagttcaagggcaagcgtttcgactgcggtggcgccgaaggc
tacatcgacgcgaccaacttctgcttcgagaacttctacaagacgggcaaggcttactga

DBGET integrated database retrieval system