KEGG   Pseudomonas brassicacearum: PSEBR_a3446Help
Entry
PSEBR_a3446       CDS       T01472                                 

Definition
chemotaxis protein CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
pba  Pseudomonas brassicacearum
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:pba02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:pba02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4246687..4247760
Genome map
AA seq 357 aa AA seqDB search
MSKKINVLLVDDSAVVRQVLLAILSDTPDIHVMGAASDPIFAMDKLAKEWPDVIVLDVEM
PRMDGITFLKKIMSERPTPVVICSSLTPRGAETTLQAMAAGAVEIITKPTTGLKNFLLES
APELVSAIRAAAQVNVRNLGKRPAPIALTPATKLTADAMLPAANGHAMAQTTERIVALGT
STGGTQALEAVLTALPRVCPGIVIVQHMPEKFTASFAARLNSLCQIEVREARNNDRIHPG
LALIAPGGKHMMVTRSGAFYHVQVVDGPLVNRHRPSVDVLFRSVAKFAGRNATGIIMTGM
GDDGARGLKEMLDAGSTTVAQDEASCVVFGMPKEAIKLNAAQRVMGLQEIAQVILHR
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaaagatcaatgtactgctggtggatgactctgccgtggttcgccaggtgttg
ctggcgatcctcagcgacacaccggacatccacgtcatgggcgcggcgtccgacccgatt
ttcgccatggacaaactggccaaggaatggcccgacgtgatcgtgctggacgtggaaatg
ccgcgcatggacggcatcacgttcctgaagaaaatcatgagcgagcgccccactccggtg
gtgatctgctcgtccctgacaccccggggcgcggaaaccaccttgcaggcgatggccgct
ggtgcggtggagatcatcaccaagcccaccaccggcctgaagaactttctgttggagtcg
gcgccggagctggtgtcggcgatccgtgccgccgcccaggtcaacgtgcgcaacctgggc
aagcgccccgccccgatcgcgctgacacccgcgaccaaactcaccgccgacgccatgttg
cccgccgccaacggccacgccatggcgcagaccaccgaacgcatcgtcgccctgggcacc
tccaccggcggcacgcaggccctggaagcggtgctcaccgccctgccgcgagtgtgcccg
ggcatcgtcatcgtccagcacatgccggaaaaattcaccgcctcgtttgccgcccggctc
aacagcctgtgccagatcgaagtgcgcgaggcccgcaacaacgaccgtatccacccgggc
ctggcgctcatcgcaccaggcggcaaacacatgatggtgacccgcagcggcgcgttctat
cacgtgcaggtggtggacggcccgctggtcaaccgccaccgcccttcggtggatgtgctg
ttccgctccgtggccaaattcgccggccgcaacgccaccggcatcatcatgaccggcatg
ggcgacgacggcgcccgcggcctgaaggaaatgctcgacgccggcagcaccaccgtggcc
caggacgaagccagctgcgtagtcttcggcatgcccaaggaagcgatcaaactcaacgcc
gcacaacgagtgatggggttgcaggagattgcgcaggtgattctgcatcggtaa

DBGET integrated database retrieval system