KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a3580Help
Entry
PSEBR_a3580       CDS       T01472                                 

Definition
(GenBank) Isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Pathway
pba00630  Glyoxylate and dicarboxylate metabolism
pba01100  Metabolic pathways
pba01110  Biosynthesis of secondary metabolites
pba01120  Microbial metabolism in diverse environments
pba01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pba00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PSEBR_a3580
Enzymes [BR:pba01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     PSEBR_a3580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AEA69919
UniProt: F2KIP3
Position
4393969..4395294
Genome map
AA seq 441 aa AA seqDB search
MALTREQQIAALEKDWAENPRWKGVKRNYSAADVVRLRGSVQPEHTLAKMGADKLWNLVT
QGAKPAFRPEKDFVNCMGALTGGQAVQQVKAGIQAIYLSGWQVAADNNSAESMYPDQSLY
PVDSVPTVVKRINNSFRRADQIQWKAGKNPGDEGYIDYFAPIVADAEAGFGGVLNAYELM
KSMIEAGAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLTAARLAADVAGVPTIILAR
TDANAADLLTSDCDPYDQPFVTGTRTQEGFYKVRAGLDQAIARGLAYAPYADLIWCETAK
PDLDEARRFAEAIKKEYPDQILSYNCSPSFNWKKNLDDATIAKFQRELSAMGYKHQFITL
AGIHNMWHSMFNLAHDYARNDMTAYVKLQEQEFADAAKGYTFVAHQQEVGTGYFDDMTTV
IQGGTSSVTALTGSTEEEQFH
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggcactgacacgcgaacagcaaattgcagcccttgaaaaagattgggctgaaaacccg
cgctggaaaggcgtgaagcgcaattattccgctgctgacgtcgtccgtctgcgtggctcg
gttcaacctgagcacacccttgcgaaaatgggcgccgacaagctctggaacctggtcacc
cagggcgccaagccagccttccgtcccgagaaagatttcgtcaactgcatgggcgccctg
accggcggccaggctgtgcagcaagtcaaggccggcatccaggcgatctacctgtcgggc
tggcaagtggccgcggacaacaactccgccgagtcgatgtaccccgaccagtcgctgtac
ccggtggattcggttccaaccgtggtcaagcgcatcaacaactcgttccgtcgcgccgac
cagatccagtggaaagccggcaagaacccgggcgacgaaggctacatcgactacttcgcg
ccgatcgtggctgacgctgaagccggtttcggtggcgtcctgaacgcctacgagctgatg
aaaagcatgatcgaagcaggcgccgccggcgttcacttcgaagaccaactggcttcggtg
aagaaatgcggccacatgggcggcaaggtactggttccaacccaggaagctgtgcagaag
ctgaccgctgcccgcctggccgccgacgttgccggtgtaccaaccatcatcctggcccgt
accgacgccaacgccgctgacctgctgacctccgactgcgacccgtacgaccaaccgttc
gtaaccggtacccgcacccaggaaggcttctacaaggtgcgtgccggtctcgaccaagcc
atcgcccgtggcctggcctacgcaccgtacgccgacctgatctggtgcgaaaccgccaag
ccggacctggacgaggcgcgtcgcttcgccgaagcgatcaagaaggaatacccagaccag
atcctgtcgtacaactgctcgccttccttcaactggaagaaaaacctggacgacgcgacc
atcgccaagttccagcgcgaactgtccgccatgggctacaagcaccagttcatcaccctg
gccggcattcacaacatgtggcacagcatgttcaacctggcgcacgactacgcccgcaac
gacatgaccgcctacgtgaagctgcaagagcaagagttcgctgacgccgccaagggctac
accttcgtcgctcaccagcaggaagtgggcaccggctacttcgacgacatgaccaccgtg
atccagggcggcacttcgtcggtgaccgcactgaccggttccaccgaagaagaacagttc
cactga

DBGET integrated database retrieval system