KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a3580Help
Entry
PSEBR_a3580       CDS       T01472                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSEBR_a3580
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PSEBR_a3580
Enzymes [BR:pba01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     PSEBR_a3580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4393969..4395294
Genome map
AA seq 441 aa AA seqDB search
MALTREQQIAALEKDWAENPRWKGVKRNYSAADVVRLRGSVQPEHTLAKMGADKLWNLVT
QGAKPAFRPEKDFVNCMGALTGGQAVQQVKAGIQAIYLSGWQVAADNNSAESMYPDQSLY
PVDSVPTVVKRINNSFRRADQIQWKAGKNPGDEGYIDYFAPIVADAEAGFGGVLNAYELM
KSMIEAGAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLTAARLAADVAGVPTIILAR
TDANAADLLTSDCDPYDQPFVTGTRTQEGFYKVRAGLDQAIARGLAYAPYADLIWCETAK
PDLDEARRFAEAIKKEYPDQILSYNCSPSFNWKKNLDDATIAKFQRELSAMGYKHQFITL
AGIHNMWHSMFNLAHDYARNDMTAYVKLQEQEFADAAKGYTFVAHQQEVGTGYFDDMTTV
IQGGTSSVTALTGSTEEEQFH
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggcactgacacgcgaacagcaaattgcagcccttgaaaaagattgggctgaaaacccg
cgctggaaaggcgtgaagcgcaattattccgctgctgacgtcgtccgtctgcgtggctcg
gttcaacctgagcacacccttgcgaaaatgggcgccgacaagctctggaacctggtcacc
cagggcgccaagccagccttccgtcccgagaaagatttcgtcaactgcatgggcgccctg
accggcggccaggctgtgcagcaagtcaaggccggcatccaggcgatctacctgtcgggc
tggcaagtggccgcggacaacaactccgccgagtcgatgtaccccgaccagtcgctgtac
ccggtggattcggttccaaccgtggtcaagcgcatcaacaactcgttccgtcgcgccgac
cagatccagtggaaagccggcaagaacccgggcgacgaaggctacatcgactacttcgcg
ccgatcgtggctgacgctgaagccggtttcggtggcgtcctgaacgcctacgagctgatg
aaaagcatgatcgaagcaggcgccgccggcgttcacttcgaagaccaactggcttcggtg
aagaaatgcggccacatgggcggcaaggtactggttccaacccaggaagctgtgcagaag
ctgaccgctgcccgcctggccgccgacgttgccggtgtaccaaccatcatcctggcccgt
accgacgccaacgccgctgacctgctgacctccgactgcgacccgtacgaccaaccgttc
gtaaccggtacccgcacccaggaaggcttctacaaggtgcgtgccggtctcgaccaagcc
atcgcccgtggcctggcctacgcaccgtacgccgacctgatctggtgcgaaaccgccaag
ccggacctggacgaggcgcgtcgcttcgccgaagcgatcaagaaggaatacccagaccag
atcctgtcgtacaactgctcgccttccttcaactggaagaaaaacctggacgacgcgacc
atcgccaagttccagcgcgaactgtccgccatgggctacaagcaccagttcatcaccctg
gccggcattcacaacatgtggcacagcatgttcaacctggcgcacgactacgcccgcaac
gacatgaccgcctacgtgaagctgcaagagcaagagttcgctgacgccgccaagggctac
accttcgtcgctcaccagcaggaagtgggcaccggctacttcgacgacatgaccaccgtg
atccagggcggcacttcgtcggtgaccgcactgaccggttccaccgaagaagaacagttc
cactga

DBGET integrated database retrieval system