KEGG   Pseudomonas brassicacearum: PSEBR_a3941Help
Entry
PSEBR_a3941       CDS       T01472                                 

Definition
Xaa-Pro aminopeptidase
Orthology
K01262  
Xaa-Pro aminopeptidase [EC:3.4.11.9]
Organism
pba  Pseudomonas brassicacearum
Brite
Enzymes [BR:pba01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.9  Xaa-Pro aminopeptidase
     PSEBR_a3941
Peptidases [BR:pba01002]
 Metallo Peptidases
  Family M24
   PSEBR_a3941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4850519..4852327)
Genome map
AA seq 602 aa AA seqDB search
MSTEPMPHGLVPQRLAQIRQLMSREGIHALLVPSADPHLSEYLPGYWQGRQWLSGFHGSV
GTLIVTGSFAGVWADSRYWEQATKELEGSGIELVKLIPGQPGPLDWLAEQTPEGGVVAVD
GAVMAVASARTLGGKLAERGARLRTDIDLLQEVWSDRPSLPDQPVYAHLPPQATVSRVEK
LAKLRESLKERGADWHFIATLDDIAWLFNLRGADVSFNPVFVSFALISQQQATLFVALDK
VDAALRAVLEQDGVTLRDYSEAAAALREVPDGASLQIDPARVTVGLLDNLGSGVKLVEGL
NPTTLAKSRKSLADAEHIRRAMEQDGAALCEFFAWLEGAWGRERITELTIDEHLTAARTR
RPDFVSLSFNTIAAFNANGAMPHYHATEEAHAVIEGDGLLLIDSGGQYLGGTTDITRMVP
VGTPTTEQKRDCTRVLKGVIALSRAKFPRGILSPLLDGIARAPIWAEQVDYGHGTGHGVG
YFLNVHEGPQVIAYQAAAAPQTAMQAGMITSIEPGTYRPGRWGVRIENLVLNRDAGSSEF
GEFLEFETLTLCPIDTRCLEPSLLTQDEKDWFNAYHAEVQRRLSPLLDGDALQWLNTRTI
AI
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgagcctatgccccatggactggttccccagcgcctggcccaaatccgccaa
ctgatgagccgagagggcattcatgcgctgctggtgccatcagccgacccgcatctgtct
gaatacttgccgggctattggcagggacggcaatggctgtcgggcttccacggctcggtg
ggtaccttgatcgtgaccggcagtttcgctggcgtctgggccgatagccgttattgggag
caggccaccaaggaactggagggcagtggtatcgagctggtcaagctcattcctggccag
cccggccccttggactggctggccgaacaaacacctgagggtggggtggtcgccgttgac
ggtgcggtcatggccgtggcatcggcccgcaccctgggtggcaagcttgcggagcgcggc
gcgcggttgcgtaccgacatcgatctgctccaggaggtctggagcgatcgccctagcttg
ccggatcagccggtctacgcccatttaccaccccaggcgaccgtcagccgggtcgagaaa
ctcgccaagctgcgcgaatccctcaaggaacgaggtgccgactggcatttcatcgccacg
ctggatgacatcgcctggttgttcaacctgcgcggcgcggatgtgtcgttcaaccccgtg
ttcgtctccttcgccttgatcagccagcaacaggcaacgctgttcgtagccctggacaag
gttgacgcggcactgcgtgccgttcttgaacaggacggcgtgaccctgcgcgattacagc
gaagccgccgccgcgttgcgcgaagtgccggacggcgcgagcttgcagatcgatccggcg
cgggtgacggtcggtttgctggataacctgggcagcggcgtgaagctggtcgaaggtctc
aatccaacgacgctggccaagtcccgcaaaagcctggccgacgccgagcacatccgtcgg
gccatggagcaggatggcgcggcgctctgtgagttcttcgcctggctggaaggggcttgg
gggcgcgagcgcatcaccgagttgaccatcgacgagcacctgaccgccgcccgcacgcgc
cggccggacttcgtctccctgagtttcaacaccatcgccgcctttaacgccaacggcgcg
atgcctcattaccacgccacggaagaagcccatgcggtcatcgaaggtgatggcctgttg
ctgatcgattccggcggccagtacttggggggcactactgacatcactcgcatggtgccg
gtcggcacacccaccactgagcagaaacgtgattgcacgcgcgtgctcaagggcgtgatt
gccctgtcccgggccaaattcccgcggggtattctttcgccgttgctggatggcatcgcc
cgcgcaccgatctgggcggagcaggtggattacggccacggcacaggtcatggcgtcggc
tattttctcaatgtccacgaaggcccgcaggtgattgcctatcaagccgctgccgcgccg
caaacggcgatgcaggcgggcatgatcacctccatcgaaccgggcacttatcgccccggt
cgctggggtgtgcgcatcgagaacctggtgttgaaccgtgacgccggaagcagcgagttc
ggcgagttccttgagttcgaaaccctgaccctttgtccgatcgacacccgctgcctggaa
ccttcgctgctgacccaggacgaaaaagactggttcaacgcctaccacgccgaggttcag
cgtcgcttgagcccgttgctggacggtgacgcactgcaatggctcaacacgcgaacgata
gcgatttga

DBGET integrated database retrieval system