KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a4137Help
Entry
PSEBR_a4137       CDS       T01472                                 

Definition
(GenBank) Succinate--CoA ligase (ADP-forming)
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Pathway
pba00020  Citrate cycle (TCA cycle)
pba00640  Propanoate metabolism
pba00660  C5-Branched dibasic acid metabolism
pba01100  Metabolic pathways
pba01110  Biosynthesis of secondary metabolites
pba01120  Microbial metabolism in diverse environments
pba01130  Biosynthesis of antibiotics
pba01200  Carbon metabolism
Module
pba_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pba_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pba00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSEBR_a4137
   00640 Propanoate metabolism
    PSEBR_a4137
   00660 C5-Branched dibasic acid metabolism
    PSEBR_a4137
Enzymes [BR:pba01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PSEBR_a4137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp OKR_DC_1_N
Motif
Other DBs
NCBI-ProteinID: AEA70542
UniProt: F2KKG6
Position
complement(5051391..5052557)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQGKQLFAEYGLPVSTGYAVDTPEAAAEACDKIGGSEWVVKAQVHAGGRGKAGGV
KLVRSKEDAKAFAQQWLGKRLVTYQTDANGQPVTKILVESCTDIAKELYLGAVVDRSSRR
IVFMASTEGGVDIEKIAHDTPEKILKATIDPLVGAQPFQGRELAFQLGLEGKQVTQFAKI
FVGLAKLFQDHDLALLEVNPLVIKADGDLHCLDAKINIDANAMYRQPKLKTFHDPSQDDP
REAHAAKFELNYVALEGNIGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVTE
AFKIILSDTNVAAVLVNIFGGIVRCDMIAEGIIGAVKEVGVKIPVVVRLEGNNAELGAKV
LAESGLNIIAATSLTDAAQQVVKAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttcacgagtatcagggtaagcagctgttcgctgagtacggcctgccagtatcc
accggttacgcggtagacaccccggaagcggcagcagaagcttgcgacaaaatcggcggc
agcgaatgggttgtcaaagcccaggttcacgccggtggtcgcggtaaagcgggcggcgtc
aagctggttcgcagcaaagaagacgccaaagccttcgcacagcagtggctgggcaagcgt
ctggtgacttaccagactgacgccaacggtcagccagtcaccaagatcctggttgaatcg
tgcactgatatcgctaaagagctgtacctgggcgctgtcgttgaccgttcgagccgccgc
atcgtgttcatggcttccaccgaaggtggcgtggacatcgagaaaatcgctcacgatacc
cctgagaaaatcctcaaggccaccatcgatccactggttggcgcacagccattccagggt
cgcgagctggcattccagctgggcctggaaggcaagcaggtcactcaattcgccaagatc
ttcgtaggtctggccaagctgttccaggaccacgacctggcactgctggaagtgaacccg
ctggtgatcaaggccgacggcgacctgcactgcctcgatgccaagatcaacatcgatgcc
aacgccatgtaccgtcagcctaagctgaagactttccacgatccgtcgcaagacgatccg
cgcgaagcgcacgctgccaagttcgaactgaactacgtggccctggaaggtaacatcggc
tgcatggtcaacggtgccggcctggccatgggtaccatggacatcgtcaacctgcatggc
ggcaagccagccaacttcctcgacgtgggcggtggtgctaccaaggaacgcgtaaccgaa
gcgttcaagatcatcctgtccgacaccaacgtcgctgcagtactggtcaacatcttcggc
ggcatcgttcgctgcgacatgattgccgaaggcatcatcggcgccgtgaaagaagttggc
gtgaaaatcccggttgttgttcgccttgaaggcaacaacgctgagctgggcgctaaagta
ctggcagaaagcggtttgaacatcatcgctgctaccagcctgaccgacgctgctcaacaa
gttgtcaaagctgcggagggcaaataa

DBGET integrated database retrieval system