KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a4143Help
Entry
PSEBR_a4143       CDS       T01472                                 

Definition
(GenBank) Succinate dehydrogenase (Succinate dehydrogenase hydrophobic membrane anchor subunit)
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Pathway
pba00020  Citrate cycle (TCA cycle)
pba00190  Oxidative phosphorylation
pba00650  Butanoate metabolism
pba01100  Metabolic pathways
pba01110  Biosynthesis of secondary metabolites
pba01120  Microbial metabolism in diverse environments
pba01130  Biosynthesis of antibiotics
pba01200  Carbon metabolism
Module
pba_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pba_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pba_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pba00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSEBR_a4143
   00650 Butanoate metabolism
    PSEBR_a4143
  Energy metabolism
   00190 Oxidative phosphorylation
    PSEBR_a4143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS Fumarate_red_C
Motif
Other DBs
NCBI-ProteinID: AEA70548
UniProt: F2KBX1
Position
complement(5061158..5061526)
Genome map
AA seq 122 aa AA seqDB search
MVTNVTNLSRSGLYDWMAQRVSAVVLAAYFIFLIGYVVANPGLGYAQWHELFANNWMRIF
SLLALVALGAHAWVGMWTIATDYLTPMAFGKSATAVRFLFQAVCGVAMFAYFVWGVQILW
GI
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccaacgtcacgaacctttcgcgttcgggcctctatgactggatggcgcagcgt
gtgtctgcggtcgttctcgcggcttacttcatcttcctgatcggatatgtcgtagcaaac
ccaggcctgggctacgcccaatggcatgaactgttcgcaaacaactggatgcgtatcttc
agtctgctggcacttgttgcactgggcgctcacgcctgggtcggcatgtggaccatcgcg
accgactacctgacgccaatggcgttcggcaagtcggcgactgccgtacgtttcctcttc
caggcagtatgcggcgttgcgatgttcgcttacttcgtctggggtgtgcagattctctgg
ggtatctga

DBGET integrated database retrieval system