KEGG   Pseudomonas brassicacearum: PSEBR_a4143Help
Entry
PSEBR_a4143       CDS       T01472                                 

Definition
succinate dehydrogenase
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
pba  Pseudomonas brassicacearum
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:pba01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:pba00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:pba00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:pba00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5061158..5061526)
Genome map
AA seq 122 aa AA seqDB search
MVTNVTNLSRSGLYDWMAQRVSAVVLAAYFIFLIGYVVANPGLGYAQWHELFANNWMRIF
SLLALVALGAHAWVGMWTIATDYLTPMAFGKSATAVRFLFQAVCGVAMFAYFVWGVQILW
GI
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccaacgtcacgaacctttcgcgttcgggcctctatgactggatggcgcagcgt
gtgtctgcggtcgttctcgcggcttacttcatcttcctgatcggatatgtcgtagcaaac
ccaggcctgggctacgcccaatggcatgaactgttcgcaaacaactggatgcgtatcttc
agtctgctggcacttgttgcactgggcgctcacgcctgggtcggcatgtggaccatcgcg
accgactacctgacgccaatggcgttcggcaagtcggcgactgccgtacgtttcctcttc
caggcagtatgcggcgttgcgatgttcgcttacttcgtctggggtgtgcagattctctgg
ggtatctga

DBGET integrated database retrieval system