KEGG   Pseudomonas brassicacearum: PSEBR_a4178Help
Entry
PSEBR_a4178       CDS       T01472                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pba  Pseudomonas brassicacearum
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pba00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PSEBR_a4178
Enzymes [BR:pba01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PSEBR_a4178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5096617..5097162
Genome map
AA seq 181 aa AA seqDB search
MSLEQNYTAILGQLGEDVSREGLLDTPKRAAKAMQYLCRGYEQTLEEVTNGALFSSDNSE
MVLVKDIELYSLCEHHLLPFIGKAHVAYIPSGKVLGLSKVARIVDMYARRLQIQENLSRQ
IADAVQQVTGALGVAVVIEAKHMCMMMRGVEKQNSSMITSVMLGEFRENAATRSEFLSLI
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgtctctggaacagaattacaccgcgattctcggccaactgggcgaggacgtttcccgc
gagggcctgctcgacacgcccaagcgtgctgccaaggccatgcagtacctctgccgcggt
tatgaacagaccctggaagaagtcaccaacggtgccttgttcagctccgacaacagcgag
atggtgctggtcaaggacatcgagttgtactcgttgtgcgaacatcacctgctgcctttc
atcggcaaggctcacgtggcctacatcccgagcggcaaggtgctggggctgtcgaaagtc
gcgcgcatcgtcgacatgtatgcgcgtcgcctgcagatccaggaaaacctcagccgccag
atcgccgatgcggtccagcaagtgactggcgccctgggcgtggcggtggtgatcgaggcc
aagcacatgtgcatgatgatgcgcggtgtggaaaagcagaattcctcgatgatcacctcg
gtgatgctcggcgagttccgggaaaacgccgccactcgcagcgaattcctcagcctcatc
aagtaa

DBGET integrated database retrieval system