KEGG   Pseudomonas brassicacearum: PSEBR_a4233Help
Entry
PSEBR_a4233       CDS       T01472                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pba  Pseudomonas brassicacearum
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pba00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PSEBR_a4233
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PSEBR_a4233
Enzymes [BR:pba01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PSEBR_a4233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5159391..5159942)
Genome map
AA seq 183 aa AA seqDB search
MLMRWFAVPALLLAVTGQVWAAGCPPLLEGSLPKLRAKETIDLCQRFAGKPLVVVNTASF
CGFAPQFKGLEALNQRYKEQGLQVLGVPSNDFKQESKDGAETAKVCYVNYGVTFTMTEPQ
PVRGADAIPLFRHLAEQSSAPKWNFYKYVVDRQGNVVGSFSSRIKPDDPDFIKAVEAAIA
SRP
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgttgatgcgttggtttgctgttcccgccctgttgctggctgtgaccgggcaagtctgg
gccgccggttgcccaccgttgctggaaggttcgttgcccaagctgcgggccaaggaaacc
attgatttgtgccagcgcttcgccggcaagccgctggtggtggtcaacactgccagcttc
tgtgggttcgccccgcaattcaaaggcctcgaagcgctcaaccagcgctacaaggagcaa
gggttgcaagtgctgggtgtgccgtccaatgacttcaagcaggagtccaaggacggtgct
gaaaccgccaaggtctgctacgtcaattacggcgtgaccttcaccatgaccgaacctcaa
ccggtgcgcggtgcggatgcgataccgttgttcaggcacctggctgaacaatccagcgcg
ccgaaatggaatttctacaagtatgtggtggaccgccagggcaatgtcgtaggcagtttt
tccagccggatcaagcctgacgatcccgatttcatcaaggcggtggaagcggccattgct
tccagaccctga

DBGET integrated database retrieval system