KEGG   Pseudomonas brassicacearum: PSEBR_a4405Help
Entry
PSEBR_a4405       CDS       T01472                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pba  Pseudomonas brassicacearum
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pba00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    PSEBR_a4405
Enzymes [BR:pba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     PSEBR_a4405
Exosome [BR:pba04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PSEBR_a4405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5347895..5349400
Genome map
AA seq 501 aa AA seqDB search
MTDIQNKNYIIALDQGTTSSRAIIFDRDANVVCTAQREFAQHYPQAGWVEHDPMEIFATQ
SAVMVEALAQAGLHHDQVAAIGITNQRETTVVWDKTTGRPIYNAIVWQCRRSTEICQQLK
RDGHEQYISQTTGLVTDPYFSGTKLKWILDNVEGSRERARNGELLFGTVDSWLIWKFTGG
KVHVTDYTNASRTMLFNIHSLEWDAKMLDILDIPREMLPQVKSSSEIYGRTKSGIAIGGI
AGDQQAALFGQMCVEPGQAKNTYGTGCFLLMNTGSKAVKSNHGMLTTIACGPRGEVAYAL
EGAVFNGGSTVQWLRDELKIINDALDTEYFANKVKDSNGVYLVPAFTGLGAPYWDPYARG
ALFGLTRGVRVDHIIRAALESIAYQTRDVLDAMQQDSGERLKALRVDGGAVANNFLMQFQ
ADILGTRVERPKMRETTALGAAYLAGLACGFWGSLEELRGKAVIEREFEPQLDEQAKEKL
YAGWQKAVSRTRDWEPHEDAE
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacatacagaacaagaactacatcattgccctcgaccagggtacgaccagctcg
cgcgcgatcatcttcgaccgtgacgccaacgtggtctgcaccgcccagcgcgaattcgcc
cagcattacccacaggccggctgggtcgaacacgacccgatggaaatcttcgccacccag
agcgcggtcatggtcgaagccctcgcccaggctggcctgcaccatgaccaggtggccgcc
atcggcatcaccaaccagcgtgaaaccaccgtggtctgggacaagaccactggccggccg
atctacaacgccatcgtctggcaatgccgccgcagtaccgaaatctgccagcagctcaag
cgcgatggccacgagcaatacatcagccaaaccaccggcctggtcaccgacccgtacttt
tccggcaccaagctcaagtggatcctggacaacgtcgaaggcagccgcgagcgtgcacgc
aacggtgaactgctgttcggcaccgtcgacagctggctgatctggaaattcaccggtggc
aaggtccacgtcaccgactacaccaacgcctcgcgcaccatgctcttcaacattcactcg
ctggaatgggacgcgaagatgctcgacatcctcgacatcccccgcgaaatgctcccgcaa
gtgaaatcgtcctcggagatctatggccgcaccaagagcggcatcgccatcggcggcatt
gccggtgaccagcaggcggcccttttcggccagatgtgcgtggagccaggccaggcgaaa
aacacctacggcaccggctgcttcctgctgatgaacaccggcagcaaggccgtcaaatcc
aatcacggcatgctcaccaccatcgcctgcggcccgcgcggcgaagtggcctacgccctg
gaaggcgcggtgttcaacggcggctccacggtccagtggctgcgcgatgagctgaagatc
atcaacgacgcgctggataccgaatactttgccaacaaggtcaaggacagcaacggcgtg
tacctggtgcccgccttcaccggcctgggcgcaccgtattgggacccctatgcccgtggc
gcgctgttcggcctgacccgcggcgtacgcgtcgatcacatcattcgcgcggcgctggag
tcgattgcctaccagacccgcgacgtactcgacgccatgcaacaggattcgggtgaacgc
ctcaaggccctgcgcgtcgacggtggcgcggtggcgaacaacttcctgatgcagttccag
gccgacatcctgggtacccgggtcgaacgcccgaaaatgcgtgaaaccaccgccctgggt
gctgcgtacctggccggcctggcgtgcggcttctggggcagcctggaagaactgcgcggc
aaagcggtgatcgagcgcgaattcgaaccgcagctggacgaacaggcgaaggaaaaactc
tacgccggctggcagaaggcggtcagtcgcacccgtgactgggaaccccatgaagacgct
gaataa

DBGET integrated database retrieval system