KEGG   Pseudomonas brassicacearum: PSEBR_a4441Help
Entry
PSEBR_a4441       CDS       T01472                                 

Definition
Holliday junction ATP-dependent DNA helicase
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pba  Pseudomonas brassicacearum
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pba03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5387556..5388164)
Genome map
AA seq 202 aa AA seqDB search
MIGRLRGTLAEKQPPHLILDVNGLGYELEVPMTTLYRLPSVGEPLTLHTHLVVREDAQLL
YGFVGKRERDFFRELIRLNGVGPKLALALMSSLEVDELVRCVQSQDTSALTKVPGVGKKT
AERLLVELKDRFKAWEAVPAMFALVPNQPDAPAPAVSAESDAVTALISLGYKPQEASKAI
SAIKEKGLSTEDMIRRALKGMI
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtgattggacgcttgcgcggcaccctggctgaaaaacagccgccgcacctgattctggat
gtaaatggcctgggctatgagctggaagtgcccatgaccacgctgtatcgcttgccgtcg
gtcggcgagccgctgaccctgcacacccatttggtcgtgcgcgaggatgcgcagttactc
tatggcttcgtcggcaagcgcgagcgagacttcttccgcgagctgatccgtctcaatggc
gtcggcccgaaactggccctggccttgatgtcgagcctggaagtcgatgaattggtccgt
tgcgtgcagtcccaggacacctcggccctgaccaaggtgccgggtgtgggcaagaaaacc
gccgagcgcctgctggtcgaactcaaggaccgcttcaaggcctgggaggcggtgccggct
atgttcgccctggtgccgaaccagccggacgcgcctgcgcctgcggtcagcgccgaaagc
gatgcggtcaccgcgctgatctccctgggctacaagccgcaggaagccagcaaggcgatt
tccgccatcaaggaaaaaggcctgagcactgaagacatgattcgccgtgccctgaaggga
atgatttaa

DBGET integrated database retrieval system