KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a45Help
Entry
PSEBR_a45         CDS       T01472                                 

Definition
(GenBank) Putative diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Brite
Enzymes [BR:pba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     PSEBR_a45
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
52363..54465
Genome map
AA seq 700 aa AA seqDB search
MSDDAERWREKYLKSIEQQEKLERRWEARLDLLRRGLVRSTLAAEGTDRAVDQCMKEMRE
VVRTNDMDAGLAALLPRLEKAVLDSEQRRETRVEQTSTALIALVAQLQSLPLPKEVSRSL
KKFAKQLEDRAGQAREIPLLLSELSGLQGKALSALDAPVEPSRPGLLQRLFGGQGHEDAA
PRPHEPAQASVAPASETALPVAVAPAMAAESVAPAPAPAPAPAPAPAPAPAPAPQPSVAE
QAPALETTPEPVALTAPQLEIAPAPAPTPAAEVVQPAIEPDDQATEPAPPPTPVAEERPV
VAPALENPDELMPEEPTQALPAPSLPPAELDEPLEGVDVADAQYALPDSPEPSYSSVAKH
IEDTLLGLLGDLTLPERHRPQAEAMCERLRNGLNWYELLPILDDLAVLMLAITDTGQHEF
EAYLQRLNDRLESFQSSLQAASEDHAENLSASREMDTQIREQVDGLQSSVKEADDLESLK
QVLENHLEGLLGTMDHHRQQRDQREQEVSTRLKSLADRVALMEQDAQVVRENLEEQRQKA
LIDPLTGLPNRAAWSERLEHEVAQWQQHGNSLLLAMLDLDHFKRINDNYGHLAGDRVLKL
IASVLRKRLRGGDFIARFGGEEFVLLVPNTPLVAGAKLAEALRLAIEACPFHFKGEPVTV
TVSIGLTAFKPGEHSDLVLKRADQALYRAKNSGRNHVELG
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgacgctgaacgctggagagagaagtacctcaagagtatcgaacagcaggaa
aagcttgagcgccgttgggaggctcggctcgacttgctgcgtcgtggcctggtgcgcagc
accctggccgccgagggcactgaccgggctgtcgatcaatgcatgaaagagatgcgcgag
gtggtgcgcaccaatgacatggatgccggcctcgctgccctgctgccgcgcctggagaaa
gccgtactcgattccgaacagcgccgcgaaacccgggtcgaacagacgagcaccgcgttg
atcgccctggttgcccagttgcagagcctgccgctgcccaaagaagtcagccggtcgctg
aagaagtttgccaagcaactggaggatcgggccggccaggcccgggagattccgctgttg
ctcagcgaattgagcggtttgcaaggcaaggcactcagtgccctggatgcccctgtcgaa
ccgagtcgccccggcctgctgcaacggctgtttggtggccaaggccatgaggacgcggcg
ccacggccccacgagcctgcccaggccagcgtggcacctgcgtcggaaactgccctgccc
gtagccgtggcgccggccatggccgcagaatccgtcgcaccagcaccagcaccagcacca
gcaccagcaccagcaccagcaccagcaccagcaccagcaccgcagccatcggtggcggag
caagcgccagcgttggagacgacgcccgaaccggttgccctgactgcgccgcagctcgag
atcgctccagcacccgctccaacacctgcagccgaagtggttcagcccgccattgaaccg
gacgaccaggcgaccgagcccgcgccgccgccgacgccggtcgccgaagaacgcccggtt
gtggcacccgcactcgagaatcccgacgagctgatgcccgaggagcctacccaggccctg
cccgccccctcgttgccgcctgcggagctcgacgagcccctggaaggcgtcgatgtggct
gacgcccaatacgccctgcccgactcgccggagccgtcctacagctcggtcgccaagcat
atcgaagacacgctgttgggcctcttgggcgacctgaccttgcccgagcgtcatcgacca
caagccgaagccatgtgtgagcgtctgcgcaatggcttgaactggtacgaattgctgccg
atcctcgatgatctggccgtgctgatgctggccatcacggacaccggccagcatgaattc
gaagcgtacctgcagcgcctcaacgatcggctcgagtcattccagagcagcctgcaggcc
gccagtgaagaccacgccgaaaacctgtcggcctccagggaaatggacacccagattcgt
gaacaggtggacggcctgcaaagcagcgtgaaggaagccgatgacctggaaagcctcaag
caggtgctcgagaatcacctcgaaggcttgctcggtacgatggaccaccaccgccagcaa
cgtgatcaacgcgagcaggaggtttcgacccgcctgaaaagcctggccgatcgcgttgcg
ctgatggagcaggatgcccaggtcgtgcgggagaatctcgaggagcagcggcaaaaagcc
ctgatcgacccgctcaccgggctgcccaaccgcgccgcctggtccgagcgcctggagcat
gaagtcgcccagtggcagcaacacggcaacagcttgctgctggccatgctcgatctcgat
catttcaagcgcatcaatgacaactatggccatctggccggtgaccgggtgttgaaactc
atcgcctcggtcctgcgtaaacgcctgcgtggcggcgatttcattgcgcgttttggtggc
gaggagtttgttctgctggtgcccaacactcccctggtggccggcgccaagctggccgag
gcgctgcgcctggccatcgaagcctgtccgtttcatttcaagggcgagccggtgacggtg
acggtatccattggcctgaccgccttcaaacctggcgaacatagcgatttggtgcttaaa
agagccgatcaggcgctttatcgggcaaaaaattccgggcgcaaccatgtggaattgggc
taa

DBGET integrated database retrieval system