KEGG   Pseudomonas brassicacearum: PSEBR_a45Help
Entry
PSEBR_a45         CDS       T01472                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
pba  Pseudomonas brassicacearum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
52363..54465
Genome map
AA seq 700 aa AA seqDB search
MSDDAERWREKYLKSIEQQEKLERRWEARLDLLRRGLVRSTLAAEGTDRAVDQCMKEMRE
VVRTNDMDAGLAALLPRLEKAVLDSEQRRETRVEQTSTALIALVAQLQSLPLPKEVSRSL
KKFAKQLEDRAGQAREIPLLLSELSGLQGKALSALDAPVEPSRPGLLQRLFGGQGHEDAA
PRPHEPAQASVAPASETALPVAVAPAMAAESVAPAPAPAPAPAPAPAPAPAPAPQPSVAE
QAPALETTPEPVALTAPQLEIAPAPAPTPAAEVVQPAIEPDDQATEPAPPPTPVAEERPV
VAPALENPDELMPEEPTQALPAPSLPPAELDEPLEGVDVADAQYALPDSPEPSYSSVAKH
IEDTLLGLLGDLTLPERHRPQAEAMCERLRNGLNWYELLPILDDLAVLMLAITDTGQHEF
EAYLQRLNDRLESFQSSLQAASEDHAENLSASREMDTQIREQVDGLQSSVKEADDLESLK
QVLENHLEGLLGTMDHHRQQRDQREQEVSTRLKSLADRVALMEQDAQVVRENLEEQRQKA
LIDPLTGLPNRAAWSERLEHEVAQWQQHGNSLLLAMLDLDHFKRINDNYGHLAGDRVLKL
IASVLRKRLRGGDFIARFGGEEFVLLVPNTPLVAGAKLAEALRLAIEACPFHFKGEPVTV
TVSIGLTAFKPGEHSDLVLKRADQALYRAKNSGRNHVELG
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgacgctgaacgctggagagagaagtacctcaagagtatcgaacagcaggaa
aagcttgagcgccgttgggaggctcggctcgacttgctgcgtcgtggcctggtgcgcagc
accctggccgccgagggcactgaccgggctgtcgatcaatgcatgaaagagatgcgcgag
gtggtgcgcaccaatgacatggatgccggcctcgctgccctgctgccgcgcctggagaaa
gccgtactcgattccgaacagcgccgcgaaacccgggtcgaacagacgagcaccgcgttg
atcgccctggttgcccagttgcagagcctgccgctgcccaaagaagtcagccggtcgctg
aagaagtttgccaagcaactggaggatcgggccggccaggcccgggagattccgctgttg
ctcagcgaattgagcggtttgcaaggcaaggcactcagtgccctggatgcccctgtcgaa
ccgagtcgccccggcctgctgcaacggctgtttggtggccaaggccatgaggacgcggcg
ccacggccccacgagcctgcccaggccagcgtggcacctgcgtcggaaactgccctgccc
gtagccgtggcgccggccatggccgcagaatccgtcgcaccagcaccagcaccagcacca
gcaccagcaccagcaccagcaccagcaccagcaccagcaccgcagccatcggtggcggag
caagcgccagcgttggagacgacgcccgaaccggttgccctgactgcgccgcagctcgag
atcgctccagcacccgctccaacacctgcagccgaagtggttcagcccgccattgaaccg
gacgaccaggcgaccgagcccgcgccgccgccgacgccggtcgccgaagaacgcccggtt
gtggcacccgcactcgagaatcccgacgagctgatgcccgaggagcctacccaggccctg
cccgccccctcgttgccgcctgcggagctcgacgagcccctggaaggcgtcgatgtggct
gacgcccaatacgccctgcccgactcgccggagccgtcctacagctcggtcgccaagcat
atcgaagacacgctgttgggcctcttgggcgacctgaccttgcccgagcgtcatcgacca
caagccgaagccatgtgtgagcgtctgcgcaatggcttgaactggtacgaattgctgccg
atcctcgatgatctggccgtgctgatgctggccatcacggacaccggccagcatgaattc
gaagcgtacctgcagcgcctcaacgatcggctcgagtcattccagagcagcctgcaggcc
gccagtgaagaccacgccgaaaacctgtcggcctccagggaaatggacacccagattcgt
gaacaggtggacggcctgcaaagcagcgtgaaggaagccgatgacctggaaagcctcaag
caggtgctcgagaatcacctcgaaggcttgctcggtacgatggaccaccaccgccagcaa
cgtgatcaacgcgagcaggaggtttcgacccgcctgaaaagcctggccgatcgcgttgcg
ctgatggagcaggatgcccaggtcgtgcgggagaatctcgaggagcagcggcaaaaagcc
ctgatcgacccgctcaccgggctgcccaaccgcgccgcctggtccgagcgcctggagcat
gaagtcgcccagtggcagcaacacggcaacagcttgctgctggccatgctcgatctcgat
catttcaagcgcatcaatgacaactatggccatctggccggtgaccgggtgttgaaactc
atcgcctcggtcctgcgtaaacgcctgcgtggcggcgatttcattgcgcgttttggtggc
gaggagtttgttctgctggtgcccaacactcccctggtggccggcgccaagctggccgag
gcgctgcgcctggccatcgaagcctgtccgtttcatttcaagggcgagccggtgacggtg
acggtatccattggcctgaccgccttcaaacctggcgaacatagcgatttggtgcttaaa
agagccgatcaggcgctttatcgggcaaaaaattccgggcgcaaccatgtggaattgggc
taa

DBGET integrated database retrieval system