KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a4514Help
Entry
PSEBR_a4514       CDS       T01472                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Brite
Enzymes [BR:pba01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     PSEBR_a4514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5488008..5488967
Genome map
AA seq 319 aa AA seqDB search
MASHGLILALGLLVGSSVTAHAEPLDEPLKPLPPAPALDPKHVQLGLRLFNDPRLSVNNT
LSCASCHRLDRGGADDKPFSLGFDGKPVEVNTPTVFNAGLNFHQFWDGRVDTLEEQVHMV
VTSPVEMGSTWESVVKRIADDPGYAKDFKDAYPDGVTKPNIQGALADYERTLQTPNSRFD
QYLLGNTDILTPREKFGYQRFKEYGCIACHQGVNIGGNMFQKFGVMGDYIKDRGNPTRAD
EGRYNITGDEADRQVFKVPSLRNVAVTAPYFHDASAPTLERAVEVMFKYQLGREPLKNDT
TLIVEFLKTLTGESEGKPL
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcacatggactgattctggctctcggcctgctcgtgggatcaagcgtgaccgct
cacgccgagccactggacgaacccctcaaacccctgccaccggctccggccctggacccc
aagcacgtccaactggggctacggctgttcaatgacccgcggctgtcggtcaacaacacc
ctgtcctgcgccagttgccatcgcctggacagaggcggcgccgacgacaagccgttttcc
ttaggcttcgacggcaagccggtggaggtcaacacgcccaccgtgttcaatgccggcctg
aacttccaccagttctgggatggacgcgtcgacacgttggaagaacaggtgcacatggtc
gtgaccagcccggtggaaatgggcagcacctgggaatcggtcgtcaagcgcatcgccgat
gaccccggctatgccaaggacttcaaggacgcgtaccccgatggcgtgaccaagcccaat
atccagggcgcactggccgattacgagcgcaccttgcagacacccaattcgcgcttcgac
caatacctgctgggcaataccgacatcctcacgccccgggaaaagttcggttaccagcgc
ttcaaggagtacggctgcatcgcctgccaccaaggcgtgaacatcggcggcaacatgttc
cagaagttcggggtcatgggcgactacatcaaggaccggggcaaccccacccgagccgac
gaaggacgctacaacattaccggcgacgaagccgaccgccaggtcttcaaggtgcccagc
ctgcgcaacgtggccgtcaccgccccgtatttccatgacgcgtcggcaccgaccctggaa
cgcgcggtggaggtcatgttcaagtaccaactgggccgcgagcctctgaaaaacgatacg
accctgatcgtcgagttcctcaagaccctgaccggcgaatcggagggcaagcctctatga

DBGET integrated database retrieval system