KEGG   Pseudomonas brassicacearum: PSEBR_a4551Help
Entry
PSEBR_a4551       CDS       T01472                                 

Definition
pyridoxal phosphate biosynthetic protein
Orthology
K03474  
pyridoxine 5-phosphate synthase [EC:2.6.99.2]
Organism
pba  Pseudomonas brassicacearum
Pathway
Vitamin B6 metabolism
Metabolic pathways
Module
Pyridoxal biosynthesis, erythrose-4P => pyridoxal-5P
Brite
KEGG Orthology (KO) [BR:pba00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PSEBR_a4551
Enzymes [BR:pba01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.99  Transferring other nitrogenous groups
    2.6.99.2  pyridoxine 5'-phosphate synthase
     PSEBR_a4551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5539134..5539877)
Genome map
AA seq 247 aa AA seqDB search
MSTSNRILLGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERD
VLLLKDVLQTRMNFEMGVTEEMMAFAERIRPAHICLVPETRQELTTEGGLDVAGQEARIS
MAVERLSKIGAEVSLFIDADERQIEASKRVGAPAIELHTGRYADAQTPTDVADELQRVAD
GVACGLAQGLIVNAGHGLHYHNVEAVAAIKGINELNIGHALVAHALFVGFKSAVAEMKAL
ILAAAKP
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaccagcaatcgcattcttctcggcgtgaacatcgaccatgtcgccaccctgcgt
caggcccgcggtacgcgttacccggatccggtcaaggccgcactggacgcggaagaggcg
ggcgccgacggcatcaccgttcacctgcgtgaagaccgtcgtcacatccaggagcgggac
gtgctgctgctcaaggatgtgctgcaaacccgcatgaacttcgagatgggcgtgaccgaa
gaaatgatggcgttcgccgagcgcatccgcccggcgcacatctgcctggtgccggagacg
cgccaggagctgaccaccgaaggcggcctcgacgtggcggggcaggaggcgcggatcagc
atggcggtggaacgcctgtcgaagatcggcgccgaggtgtcgctgttcattgatgccgac
gaacggcagatcgaggcgtccaagcgtgttggcgcgccggccatcgaactgcacaccggc
cgttacgccgatgcccagacccccacggatgtggccgacgagctgcagcgagtagctgac
ggcgtcgcctgtggcctggcccagggcctgatcgtcaacgccggccatggcctgcactat
cacaacgtcgaagccgtcgcggccatcaagggcatcaacgagctgaacatcggccacgcg
ctggtggcccatgcgttgttcgtcgggttcaagtcggcggtagcggaaatgaaagcgttg
atcctggctgccgccaaaccctga

DBGET integrated database retrieval system