KEGG   Pseudomonas brassicacearum: PSEBR_a4560Help
Entry
PSEBR_a4560       CDS       T01472                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
pba  Pseudomonas brassicacearum
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:pba00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:pba00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:pba03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:pba03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pba03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5549454..5549882
Genome map
AA seq 142 aa AA seqDB search
MTKVDFYILPSADPSARLDFACKLVEKAWRMGHRIYLHCSDAAQREDLDARLWAFKGESF
VPHGPAESEPEGLIVLGLGDDCGQHQDLLVNLDLKVPAFAQRFARVAEVVVEDPAIRQAA
RESFRFYREQGYPLQDHRLQRL
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagtcgatttctatatcctgcccagcgccgacccgtcggcgcggctggatttt
gcctgcaagctcgttgaaaaagcctggcgcatggggcaccgcatctacctgcattgcagc
gatgccgcccagcgcgaggacctggacgcacgcctgtgggccttcaagggcgagagcttc
gtgccccacggcccggccgagagcgaacccgaagggttgatcgtgctggggctgggggat
gactgcggccagcaccaggacctgctggtaaacctcgacctgaaagtaccggcctttgcc
cagcgcttcgcccgtgtggcggaagtggtggtcgaagacccggccatccgacaagccgcg
cgggagagtttccgtttctaccgcgaacagggctatcctctgcaagaccaccgtttacag
cgactctga

DBGET integrated database retrieval system