KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a4560Help
Entry
PSEBR_a4560       CDS       T01472                                 

Definition
(GenBank) Putative DNA polymerase III, chi subunit
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Pathway
pba00230  Purine metabolism
pba00240  Pyrimidine metabolism
pba01100  Metabolic pathways
pba03030  DNA replication
pba03430  Mismatch repair
pba03440  Homologous recombination
Module
pba_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:pba00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PSEBR_a4560
   00240 Pyrimidine metabolism
    PSEBR_a4560
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PSEBR_a4560
   03430 Mismatch repair
    PSEBR_a4560
   03440 Homologous recombination
    PSEBR_a4560
Enzymes [BR:pba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     PSEBR_a4560
DNA replication proteins [BR:pba03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     PSEBR_a4560
DNA repair and recombination proteins [BR:pba03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     PSEBR_a4560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi CobS_N
Motif
Other DBs
NCBI-ProteinID: AEA70974
UniProt: F2KL12
Position
5549454..5549882
Genome map
AA seq 142 aa AA seqDB search
MTKVDFYILPSADPSARLDFACKLVEKAWRMGHRIYLHCSDAAQREDLDARLWAFKGESF
VPHGPAESEPEGLIVLGLGDDCGQHQDLLVNLDLKVPAFAQRFARVAEVVVEDPAIRQAA
RESFRFYREQGYPLQDHRLQRL
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagtcgatttctatatcctgcccagcgccgacccgtcggcgcggctggatttt
gcctgcaagctcgttgaaaaagcctggcgcatggggcaccgcatctacctgcattgcagc
gatgccgcccagcgcgaggacctggacgcacgcctgtgggccttcaagggcgagagcttc
gtgccccacggcccggccgagagcgaacccgaagggttgatcgtgctggggctgggggat
gactgcggccagcaccaggacctgctggtaaacctcgacctgaaagtaccggcctttgcc
cagcgcttcgcccgtgtggcggaagtggtggtcgaagacccggccatccgacaagccgcg
cgggagagtttccgtttctaccgcgaacagggctatcctctgcaagaccaccgtttacag
cgactctga

DBGET integrated database retrieval system