KEGG   Pseudomonas brassicacearum: PSEBR_a4712Help
Entry
PSEBR_a4712       CDS       T01472                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pba  Pseudomonas brassicacearum
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pba00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5718255..5718815
Genome map
AA seq 186 aa AA seqDB search
MTLSLPQNYREILLGLGENPEREGLLDTPVRAAKAMQYLCHGYEQSVEQIVNGALFASDS
DEMVIVADIELYSLCEHHLLPFIGKAHVAYIPTGKVLGLSKIARLVDMFARRLQIQENLT
RQIADAVQQVTQAAGVAVVIEAQHMCMMMRGVEKQNSTMNTSVMLGAFRDSSTTRQEFLQ
LIRRSN
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgacgctatccctgccccagaactaccgcgagatccttttaggcctgggggaaaacccc
gagcgcgaaggtctgctcgataccccggtccgtgccgccaaggccatgcagtacctctgc
catgggtatgaacaaagcgtcgagcagatcgtcaacggcgcgctgttcgcctctgacagc
gatgaaatggtgatcgtcgccgacatcgaactctattcactctgcgaacatcacctgttg
cccttcatcggcaaggcccatgtggcttatattcctacgggcaaggtcctggggctgtcg
aaaatcgcccggctggtggacatgttcgcccgccgcctgcaaatccaggagaacctgacc
cggcaaatcgccgacgcggtgcagcaggtcacccaggccgccggcgtggcggtggtgatc
gaggcccagcacatgtgcatgatgatgcgcggtgtcgaaaaacagaactcgaccatgaac
acctcggtgatgctcggcgcctttcgcgattccagcaccacgcgccaggagttcctgcaa
ttgattcgacggagcaattaa

DBGET integrated database retrieval system