KEGG   Pseudomonas brassicacearum: PSEBR_a4762Help
Entry
PSEBR_a4762       CDS       T01472                                 

Definition
4-(cytidine 5-diphospho)-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pba  Pseudomonas brassicacearum
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pba00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PSEBR_a4762
Enzymes [BR:pba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     PSEBR_a4762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5768237..5769088
Genome map
AA seq 283 aa AA seqDB search
MSAARLTLPSPAKLNLMLHILGRRPDGYHELQTIFQFLDYGDEITFAVRDDGVIRLHTEF
EGVPHDSNLIVKAAKKLQAQSGCPLGIDIWIEKILPMGGGIGGGSSNAATTLLGLNHLWQ
LGWDADRLAALGLTLGADVPVFVRGHAAFAEGVGEKLTPVDPEEPWYLVLVPQVSVSTAE
IFSDPLLTRNSPPIKVRPVPKGNSRNDCLPVVARRYPDVRNALNLLGKFTEAKLTGTGSC
VFGGFPSKAEADKVSALLTETLTGFVAKGSNVSMLHRKLQDLL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgcacgcctgaccctgccctccccggccaagctcaacctgatgctgcacatc
ctcggtcgtcgcccggacggctaccacgagctgcagacgatttttcagttcctggactac
ggcgacgaaatcacctttgccgtacgcgacgacggcgtgattcgcctgcacaccgaattc
gaaggcgttccccacgacagcaacctgatcgtcaaggccgcgaaaaaactccaggcacaa
tccggctgtccgctgggcatcgatatctggatcgaaaagatcctgcccatgggtggcggc
atcggtggcggcagctcgaatgcggccaccacgctgctgggtctcaaccacttgtggcaa
ctgggctgggacgcggatcgcctggccgccctgggcctgacactgggcgccgacgtgccg
gttttcgtgcgtggccacgccgctttcgccgagggcgtaggggaaaaactcaccccggtg
gaccccgaagaaccctggtacttggtgctggtgccgcaagtctctgtaagtacagcagaa
attttttcagatccactgttgacacgtaactctcctcccattaaagtgcgccccgttccc
aagggaaacagtcgaaatgactgcttaccggtggtagcaaggcgttatccagatgttcgt
aacgctttgaatttgttaggtaaatttaccgaagcaaaactcaccggaactggaagttgt
gtgtttgggggcttcccaagcaaagctgaagctgataaagtctcggcccttctgacagag
acccttacagggtttgtagcaaaaggaagcaacgtttcgatgttgcatcgcaagctgcaa
gacctgctctaa

DBGET integrated database retrieval system