KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a482Help
Entry
PSEBR_a482        CDS       T01472                                 

Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Pathway
pba00010  Glycolysis / Gluconeogenesis
pba00020  Citrate cycle (TCA cycle)
pba00620  Pyruvate metabolism
pba01100  Metabolic pathways
pba01110  Biosynthesis of secondary metabolites
pba01120  Microbial metabolism in diverse environments
pba01130  Biosynthesis of antibiotics
pba01200  Carbon metabolism
Module
pba_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSEBR_a482
   00020 Citrate cycle (TCA cycle)
    PSEBR_a482
   00620 Pyruvate metabolism
    PSEBR_a482
Enzymes [BR:pba01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PSEBR_a482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding GCV_H RnfC_N HlyD_D23 PYNP_C HlyD_3 NQRA CAT DEC-1_N
Motif
Other DBs
NCBI-ProteinID: AEA66627
UniProt: F2KAW7
Position
complement(597819..599453)
Genome map
AA seq 544 aa AA seqDB search
MSELIRVPDIGSGEGEVIELFVKVGDRIEADQSILTLESDKASMEVPAPKAGVIKSLKVK
LGDRLKEGDELLELEVEGAAAAPEAPAPAAAPAAAEKPAAAPAAEAAPAPAAAPAAATVQ
DIHVPDIGSSGKAKIIEVLVKVGDTVEADQSLITLESDKASMEIPSPAAGVVESIAVKLE
DEVGTGDFILKLKVAGAAAPAAPAQAAAPAAKAEAAPAPAAAPAAKAETAPVAAAPAPSG
AKVHAGPAVRQLAREFGVELSAVGPSGPHGRVLKEDVQAYVKAMMQKAKNAPAEGAAGGA
GIPPIPAVDFSRFGETEEVAMTRLMQIGASSLHRSWLNIPHVTQFDQADITELEAFRVAQ
KAVAEKAGVKLTVLPLLLKACAHLLKELPDFNASLAPSGKAVIRKKYVHIGFAVDTPEGL
LVPVIRNVDQKSLLQLAAEAAALAEKARNKKLTADDMQGACFTISSLGHIGGTGFTPIVN
APEVAILGVSKATIQPVWDGKAFQPKLMLPLSLSYDHRVINGAAAARFTKRLSDLLGDIR
TILL
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaactcattcgcgtacctgacatcggcagcggtgaaggtgaagtaattgaactg
tttgtgaaggtcggcgaccgtatcgaagccgaccagagcatcctgacgcttgaatcggac
aaggccagcatggaagtgcctgcgccgaaggccggtgtcatcaagagcctgaaagtgaag
ctgggcgaccgcctgaaagaaggcgacgaactgctggagctggaagtcgagggcgccgct
gcggcgcctgaagcgcccgcccctgctgctgccccggccgcggctgaaaagcctgccgcc
gcaccggctgccgaagcggctcccgcgccagctgctgcgcctgccgctgccacggtccag
gacattcatgtcccggacatcggctcgtcgggcaaggccaagatcatcgaagtgctggtc
aaggttggcgacaccgtcgaagccgaccagtcgctgatcaccctggaatccgacaaggcc
agcatggaaatcccatcgccggctgccggcgtggtggaaagcatcgcggtcaagctggaa
gatgaagtgggcacaggcgatttcatcctcaagctgaaagtagccggtgccgccgcacct
gccgcgcccgcccaagccgcagcgcctgccgccaaagctgaagccgctccggctccggct
gccgcgccagccgccaaggccgagactgctccggttgccgccgcgcctgcgccaagcggt
gccaaggtgcacgccggccctgcggtgcgtcagctggcccgtgaattcggtgtcgagctg
tccgccgtcggcccaagcggccctcacggtcgcgtgctgaaagaagacgtgcaagcctac
gtcaaggccatgatgcagaaggccaagaacgcaccagccgaaggcgctgctggcggcgca
ggcattccgccgatcccggcggtggacttcagccgcttcggcgaaaccgaagaagtggcc
atgactcgcctgatgcagatcggcgcgtcgagcctgcatcgcagctggctgaacattccg
cacgtgactcagttcgaccaggccgacatcaccgagctggaagctttccgcgttgcgcag
aaggccgtggcggaaaaggccggcgtcaagctgaccgtgctgccgctgctgctcaaggcc
tgtgcgcacctgctcaaggaactgccggacttcaacgcctccctggccccgagtggcaag
gctgtgatccgcaagaaatacgtgcacatcggctttgccgtcgacaccccggaaggcctg
ctggtaccggtcatccgcaacgtcgaccagaagagcctgctgcaactggctgccgaagcc
gctgccctggccgaaaaagcccggaacaagaagctcaccgccgacgacatgcaaggcgcc
tgcttcaccatctccagtctcggccacattggcggcaccggcttcacgccgatcgtcaac
gcgccggaagtggcgatcctgggtgtttccaaggccaccatccagccggtctgggacggt
aaagccttccagccgaagctgatgctgccactgtcgctgtcctacgatcaccgtgtgatc
aacggcgccgccgctgcacgcttcaccaagcgtctgagcgacctgctgggcgacatccgc
accatcctgctgtaa

DBGET integrated database retrieval system