KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a4862Help
Entry
PSEBR_a4862       CDS       T01472                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:pba00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PSEBR_a4862
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PSEBR_a4862
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    PSEBR_a4862
Enzymes [BR:pba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     PSEBR_a4862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5892876..5893994)
Genome map
AA seq 372 aa AA seqDB search
MRSKVTGAQRWVVKIGSALLTADGKGLDRQAMAVWVEQMVALHEAGVELVLVSSGAVAAG
MSRLGWTSRPSAMHELQAAAAIGQMGLVQAWESSFAEHGRHTAQILLTHDDLSDRKRYLN
ARSTLRALVELKVIPVINENDTVVTDEIRFGDNDTLAALVANLVEADLLVILTDRDGMFD
ADPRNNPDAKLIYEARADDPALDAVAGGTGGALGRGGMQTKLRAARLAARSGAHTIIVGG
RLERVLDRLKAGERIGTLLSPERGMLAARKQWLAGHLQTRGTLVLDAGAVAALSQGNKSL
LPVGVKLVQGSFRRGEMVVCVAPDGREIARGLANYSALEAQKIIGQSSDAIVGLLGYMAE
PELVHRDNLILV
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcggagcaaggtgacgggggcgcagcgctgggtcgtgaagatcggcagcgcactgctg
acggcggatggcaagggcctggaccgccaggcaatggcggtgtgggtcgagcagatggtg
gccttgcatgaggctggcgtcgagctggtattggtctcttcgggggccgtggcagccggt
atgagccgtttgggctggacgtcgcgacccagcgcgatgcatgagctgcaggccgccgcc
gccatcggccagatgggcctggtgcaggcttgggaatcaagcttcgccgagcacggtcgc
catacggcgcagatcctgctgacccacgacgacctgtccgaccgcaagcgctacctcaat
gcccgcagtaccttgcgcgcgctggtggagctcaaagtcatcccggtgatcaacgagaac
gacacggtggtcaccgacgagattcgtttcggcgataacgacaccctggcggcgctggtg
gcgaacctggtggaggcggatctactggtgatcctcacggatcgcgacggcatgttcgat
gccgatccgcgcaacaatcccgatgccaagctgatttacgaagctcgtgccgacgatcct
gcgctggacgcggtggcgggcggcacgggtggtgcgctgggccgtggcggcatgcagacc
aaactgcgcgctgcgcgtctggcggcgcgttccggggctcataccatcatcgtgggtggg
cgcttggagcgggtgctggaccgcctgaaagccggcgagcggatcggtaccttgctctcc
ccggagcgcggcatgctggcagcgcgcaagcagtggctggctgggcatctgcagacccgt
ggcacgttggtgctggatgctggcgcggtggcggccctgtcccaaggcaacaaaagcctg
ctgccagtgggtgtgaagctggtccagggcagtttccgtcggggcgaaatggtggtgtgc
gtggcgccggacggtcgtgagatcgcccgtggcctggccaactacagcgcgctggaagcg
cagaaaatcatcggtcagtcgtctgatgcgattgtcggtctgttgggttacatggcggag
cccgaactggttcaccgtgacaacctgatcctcgtctaa

DBGET integrated database retrieval system