KEGG   Pseudomonas brassicacearum: PSEBR_a5188Help
Entry
PSEBR_a5188       CDS       T01472                                 

Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
pba  Pseudomonas brassicacearum
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pba01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pba00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:pba00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6285557..6287734
Genome map
AA seq 725 aa AA seqDB search
MTEHVQVGGLQVAKVLFDFVNNEAIPGTGLTADAFWAGADKVIHDLAPKNKALLAKRDDF
QARIDAWHQARAGQAHDAVAYKAFLQDIGYLLPEAADFQATTQNVDDEIARMAGPQLVVP
VMNARFALNASNARWGSLYDALYGTDAISEADGAEKGKGYNKVRGDKVIAFARAFLDEAA
PLAAGSHVDSTAYKIVDGKLVVTLKGGSNSGLRDDAQLIGFQGDASAPTTVLLKHNGLHF
EIQIDASTPVGQTDAAGVKDILMEAALTTIMDCEDSVAAVDADDKVVIYRNWLGLMKGDL
AEEVAKGGQTFTRTMNPDRVYTAVDGSSVTLHGRSLLFVRNVGHLMTIDAILDKHGNEVP
EGILDGLITSLAAIHSLNGNTSRRNSRTGSVYIVKPKMHGPEEAAFTNELFGRVEDVLNL
PRNTLKVGIMDEERRTTVNLKACIKAASERVVFINTGFLDRTGDEIHTSMEAGPMVRKAD
MKAEKWIGAYENWNVDIGLSTGLQGRAQIGKGMWAMPDLMAAMLEQKIAHPMAGANTAWV
PSPTAAALHALHYHKVDVFARQAELAKRTRASVDDILTIPLAVNPNWTPEQIKNELDNNA
QGILGYVVRWIDQGVGCSKVPDINDIGLMEDRATLRISSQHIANWLRHGIVTQDQVMESL
KRMAPVVDRQNASDPLYRPLEPDFDRNIAFQAAVELVIEGTKQPNGYTEPVLHRRRREFK
AANGL
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacacgttcaagtcggtggcctgcaggtcgccaaagtcctgttcgacttcgtg
aataacgaagccattcccggaaccggcctcaccgccgacgcgttctgggccggtgccgac
aaggtcatccacgacctggccccgaagaacaaagccctactcgccaaacgcgatgatttc
caggcgcggatcgatgcctggcaccaggcccgtgccggccaggcccacgacgccgtggct
tacaaagccttcctgcaagacattggatacctgctgccagaagcggcggatttccaggct
acgacccaaaacgtcgatgacgaaatcgcccgcatggccggcccgcagctggtggtgccg
gtgatgaacgcccgcttcgccctcaacgcatcaaacgcccgctggggttcgctgtatgac
gcgctgtacggcaccgacgccatcagcgaagccgatggcgcggaaaaaggcaaaggctac
aacaaggtccgcggcgacaaggtcatcgccttcgcccgtgccttcctcgacgaagccgcg
cccctggcggccggctcccatgtcgattccaccgcttacaaaatcgtcgacggcaaactg
gtggtcaccctcaagggcggcagcaacagcggcctgcgtgacgatgcccagttgatcggc
ttccagggtgatgcctcggcaccgaccaccgtgctgttgaaacacaacggcctgcacttc
gaaatccagatcgatgccagcaccccggtcggacagactgacgccgctggcgttaaagac
atcctgatggaagccgcgctgaccaccatcatggactgcgaagactcggtcgccgccgtc
gatgccgatgacaaagtggtgatctaccgcaactggctcggcctgatgaaaggcgacctg
gctgaagaagtcgccaaaggtggccagacgttcacccgcaccatgaaccccgaccgtgtc
tacaccgccgtcgacggttcgagcgtgaccctgcacggccgctcgctgttgttcgtgcgt
aacgtcggccacctgatgaccatcgatgcgatcctggacaagcatggcaacgaagtgccg
gaaggcattctcgacggcctgatcaccagcctggcagcgatccacagcctcaacggcaac
accagccgtcgcaacagccgcaccggctcggtgtacatcgtcaagccgaagatgcacggc
ccggaagaagccgcgttcaccaacgagctgttcggtcgcgtcgaggacgtgctgaacctg
ccgcgcaacaccctcaaggtcgggatcatggacgaggagcgccgtaccacggtcaacctc
aaggcctgcatcaaggccgccagcgagcgcgtggtgttcatcaacaccggcttcctcgac
cgtacgggcgatgaaatccacacctccatggaagccggcccgatggtgcgcaaggccgac
atgaaagccgagaagtggatcggcgcctatgaaaactggaacgtcgacatcggcttgagc
actggcctgcaaggtcgcgcacaaatcggcaagggcatgtgggcgatgccggacctgatg
gcggcgatgctcgaacagaaaatcgcccatccaatggccggcgccaacaccgcctgggtt
ccctcgccgaccgccgctgccctgcacgcgctgcattaccacaaggtcgacgtgttcgcc
cgccaggccgaactggccaagcgcacgcgtgcatcggtggacgacatcctgaccatcccg
ctggccgtcaatccgaactggacaccggagcagatcaagaacgaactggacaacaatgcc
cagggcatccttggctacgtggtgcgctggatcgaccagggcgtgggttgttccaaggtg
ccggacatcaacgacatcggcctgatggaagaccgtgcgacgctgcgtatctccagccag
cacatcgccaactggctgcgccacggcatcgtcacccaagaccaggtgatggaaagcctc
aagcgcatggcgccggtggtcgaccgccagaacgccagcgacccgctgtaccgtccgctg
gaaccagacttcgaccgcaacatcgccttccaggcggcggtcgagctggtgatcgaaggc
acgaagcagcccaacggctacaccgagccggtgctacaccgtcgtcgtcgagagttcaag
gcagccaatgggttgtga

DBGET integrated database retrieval system