KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a5188Help
Entry
PSEBR_a5188       CDS       T01472                                 

Definition
(RefSeq) malate synthase G
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSEBR_a5188
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSEBR_a5188
   00630 Glyoxylate and dicarboxylate metabolism
    PSEBR_a5188
Enzymes [BR:pba01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PSEBR_a5188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6285557..6287734
Genome map
AA seq 725 aa AA seqDB search
MTEHVQVGGLQVAKVLFDFVNNEAIPGTGLTADAFWAGADKVIHDLAPKNKALLAKRDDF
QARIDAWHQARAGQAHDAVAYKAFLQDIGYLLPEAADFQATTQNVDDEIARMAGPQLVVP
VMNARFALNASNARWGSLYDALYGTDAISEADGAEKGKGYNKVRGDKVIAFARAFLDEAA
PLAAGSHVDSTAYKIVDGKLVVTLKGGSNSGLRDDAQLIGFQGDASAPTTVLLKHNGLHF
EIQIDASTPVGQTDAAGVKDILMEAALTTIMDCEDSVAAVDADDKVVIYRNWLGLMKGDL
AEEVAKGGQTFTRTMNPDRVYTAVDGSSVTLHGRSLLFVRNVGHLMTIDAILDKHGNEVP
EGILDGLITSLAAIHSLNGNTSRRNSRTGSVYIVKPKMHGPEEAAFTNELFGRVEDVLNL
PRNTLKVGIMDEERRTTVNLKACIKAASERVVFINTGFLDRTGDEIHTSMEAGPMVRKAD
MKAEKWIGAYENWNVDIGLSTGLQGRAQIGKGMWAMPDLMAAMLEQKIAHPMAGANTAWV
PSPTAAALHALHYHKVDVFARQAELAKRTRASVDDILTIPLAVNPNWTPEQIKNELDNNA
QGILGYVVRWIDQGVGCSKVPDINDIGLMEDRATLRISSQHIANWLRHGIVTQDQVMESL
KRMAPVVDRQNASDPLYRPLEPDFDRNIAFQAAVELVIEGTKQPNGYTEPVLHRRRREFK
AANGL
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacacgttcaagtcggtggcctgcaggtcgccaaagtcctgttcgacttcgtg
aataacgaagccattcccggaaccggcctcaccgccgacgcgttctgggccggtgccgac
aaggtcatccacgacctggccccgaagaacaaagccctactcgccaaacgcgatgatttc
caggcgcggatcgatgcctggcaccaggcccgtgccggccaggcccacgacgccgtggct
tacaaagccttcctgcaagacattggatacctgctgccagaagcggcggatttccaggct
acgacccaaaacgtcgatgacgaaatcgcccgcatggccggcccgcagctggtggtgccg
gtgatgaacgcccgcttcgccctcaacgcatcaaacgcccgctggggttcgctgtatgac
gcgctgtacggcaccgacgccatcagcgaagccgatggcgcggaaaaaggcaaaggctac
aacaaggtccgcggcgacaaggtcatcgccttcgcccgtgccttcctcgacgaagccgcg
cccctggcggccggctcccatgtcgattccaccgcttacaaaatcgtcgacggcaaactg
gtggtcaccctcaagggcggcagcaacagcggcctgcgtgacgatgcccagttgatcggc
ttccagggtgatgcctcggcaccgaccaccgtgctgttgaaacacaacggcctgcacttc
gaaatccagatcgatgccagcaccccggtcggacagactgacgccgctggcgttaaagac
atcctgatggaagccgcgctgaccaccatcatggactgcgaagactcggtcgccgccgtc
gatgccgatgacaaagtggtgatctaccgcaactggctcggcctgatgaaaggcgacctg
gctgaagaagtcgccaaaggtggccagacgttcacccgcaccatgaaccccgaccgtgtc
tacaccgccgtcgacggttcgagcgtgaccctgcacggccgctcgctgttgttcgtgcgt
aacgtcggccacctgatgaccatcgatgcgatcctggacaagcatggcaacgaagtgccg
gaaggcattctcgacggcctgatcaccagcctggcagcgatccacagcctcaacggcaac
accagccgtcgcaacagccgcaccggctcggtgtacatcgtcaagccgaagatgcacggc
ccggaagaagccgcgttcaccaacgagctgttcggtcgcgtcgaggacgtgctgaacctg
ccgcgcaacaccctcaaggtcgggatcatggacgaggagcgccgtaccacggtcaacctc
aaggcctgcatcaaggccgccagcgagcgcgtggtgttcatcaacaccggcttcctcgac
cgtacgggcgatgaaatccacacctccatggaagccggcccgatggtgcgcaaggccgac
atgaaagccgagaagtggatcggcgcctatgaaaactggaacgtcgacatcggcttgagc
actggcctgcaaggtcgcgcacaaatcggcaagggcatgtgggcgatgccggacctgatg
gcggcgatgctcgaacagaaaatcgcccatccaatggccggcgccaacaccgcctgggtt
ccctcgccgaccgccgctgccctgcacgcgctgcattaccacaaggtcgacgtgttcgcc
cgccaggccgaactggccaagcgcacgcgtgcatcggtggacgacatcctgaccatcccg
ctggccgtcaatccgaactggacaccggagcagatcaagaacgaactggacaacaatgcc
cagggcatccttggctacgtggtgcgctggatcgaccagggcgtgggttgttccaaggtg
ccggacatcaacgacatcggcctgatggaagaccgtgcgacgctgcgtatctccagccag
cacatcgccaactggctgcgccacggcatcgtcacccaagaccaggtgatggaaagcctc
aagcgcatggcgccggtggtcgaccgccagaacgccagcgacccgctgtaccgtccgctg
gaaccagacttcgaccgcaacatcgccttccaggcggcggtcgagctggtgatcgaaggc
acgaagcagcccaacggctacaccgagccggtgctacaccgtcgtcgtcgagagttcaag
gcagccaatgggttgtga

DBGET integrated database retrieval system