KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a5209Help
Entry
PSEBR_a5209       CDS       T01472                                 

Definition
(GenBank) putative formaldehyde dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Pathway
pba00625  Chloroalkane and chloroalkene degradation
pba00680  Methane metabolism
pba01100  Metabolic pathways
pba01120  Microbial metabolism in diverse environments
pba01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pba00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    PSEBR_a5209
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PSEBR_a5209
Enzymes [BR:pba01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     PSEBR_a5209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C AdoHcyase_NAD FAD_binding_2 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AEA71687
UniProt: F2KME4
Position
complement(6309148..6310347)
Genome map
AA seq 399 aa AA seqDB search
MSGNRGVVYLGNGKVEVQKIDYPKMQDPRGRKIEHGVILRVVSTNICGSDQHMVRGRTTA
QTGLVLGHEITGEVIEKGSDVENLKIGDLVSVPFNVACGRCRSCKEQHTGVCLTVNPARA
GGAYGYVDMGDWTGGQAEYVLVPYADFNLLKLPDRDKAMEKIRDLTCLSDILPTGYHGAV
TAGVGPGSTVYIAGAGPVGLAAAASARLLGAAVVIIGDVNPVRLAHAKAQGFEIADLSQD
TPLHEQIAALLGEPEVDCAVDAVGFEARGHGHDGVKHEAPATVLNSLMGVVRVAGKIGIP
GLYVTEDPGAVDAAAKMGSLSIRFGLGWAKSHSFHTGQTPVMKYNRQLMQAIMWDRINIA
EIVGVQVISLDDAPKGYGEFDAGVPKKFVIDPHKLFSAA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtaatcgtggtgtcgtgtatctcggcaacggcaaggtcgaagtacagaaaatc
gactatccaaaaatgcaggacccgcgcggcaggaagattgagcacggtgtcatcctgcgc
gtggtctccaccaacatctgcggctccgaccagcacatggtgcgcggccgtaccactgcc
cagaccggtctggtcctgggtcacgaaatcaccggtgaagtgatcgaaaagggcagcgac
gtcgagaacctgaaaatcggtgatctggtgtcggtgccgttcaacgtggcttgcgggcgc
tgccgttcctgcaaagagcaacacactggcgtctgcctgaccgtcaacccggcccgtgcc
ggcggtgcctatggttacgtggacatgggcgactggaccggcggccaggccgaatacgtg
ctggtgccgtacgccgacttcaacctgctgaaactgccggaccgcgacaaggccatggag
aaaatccgcgacctgacctgcctgtccgacatcctgccgaccggctaccacggcgctgtc
accgccggcgttggccctggcagcaccgtctacatcgccggtgctggcccggttggccta
gcggccgctgcttccgctcgcctgctgggggcagcagtggtgatcattggcgacgtcaac
ccggtccgcctggcgcacgccaaggcccagggtttcgaaatcgccgacctgtcccaggac
accccgttgcacgaacagatcgccgcgttgctgggcgagcctgaagtcgattgcgccgtc
gatgcggtaggctttgaagcccgcggccatggccatgacggcgtcaagcacgaagccccg
gccaccgtactcaactcgctgatgggcgtggtccgtgtagccggcaagatcggcatccct
ggcctctacgtcaccgaagacccgggcgctgtcgatgcggcggcgaaaatgggcagcctg
agcattcgcttcggcttgggctgggctaaatcccacagcttccacaccggccagaccccg
gtgatgaagtacaaccgccaactgatgcaggcgatcatgtgggaccgtatcaacattgct
gaaatcgtcggcgtgcaggtcatcagcctggacgacgcgccgaaaggctacggcgagttc
gatgcgggcgtgccgaagaagtttgtgattgacccgcacaagttgttcagtgcggcgtaa

DBGET integrated database retrieval system