KEGG   Pseudomonas brassicacearum: PSEBR_a5222Help
Entry
PSEBR_a5222       CDS       T01472                                 

Definition
oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
pba  Pseudomonas brassicacearum
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6326850..6330302)
Genome map
AA seq 1150 aa AA seqDB search
MTRISTPISDIQEHYDVIVIGSGYGGGIAASRLSRAGRKVCLLERGREIQPGEYPNTLLA
ATEELQVHDPDGHIGSRTGLFDLHVNAQQNVVVGCGLGGTSLINANVSLEPEPGVFEDPR
WPQAVREHQDTLLKDGYARAREMLKPNSYPASEPNLPKLDAHKKSADYLKQGAHFYKPPI
NVTFDKLPNNLNHVGVEQLPCNGCGDCVSGCNNKAKNTTLMNYLPDAWNHGAEIFCQAEV
RHLERDGDGWIVHFQYLDSGREMFSAPTLFVRADIVVVSAGTLGSTEIMLRSRDKGLSMS
SQLGENMSGNGDILGFGHNCDQVINGIGFGAHSAKELEPVGPCITSVIDMRTEGDWRSRM
VIEEGSIPGALGRAMVPSMAAFAEMIGVPTDTGFGASLKYKGREAESFLRGPYYGALHNM
QTYLIMSHDNGKGRMLLDNKDQLRIDWPGVGEQENVTLGNERLHQSTKALGGIWVENPIW
TKLLKHSIVSVHPLGGCVMGEDATQGVVNHKGQVFSGASGTDVYPGLYVTDGSVIPTSLA
VNPLLTISAVSERNVGLLAADRGWIIDYTLPSAPRKAVAAPTLGVQFTETMKGYFSTAFT
QPQGTDLSLYEAAAKRGKTDNSPIEFTLTITAADLNRMIKEPEHAATLVGTLDAPSLSSQ
PLVASNGVFNLFEQYQEQVGVRHMNYDMKLTAEDGSDYYFSAFKTVPEDNGVLNIWHDTS
TLYVTLYRGPDKTGAVIGSGVMHILPADFAKQMTTMKVLNARNERERVEALARFGKFFAG
ILWESYGGVFAGDVYFNPDAPPRLKRPLDAPPPVVHFFQTEDNVELRLTRYQAGTKGPVM
LVHGLGVGSNIFSTDTIHTNLLEYLCKHEYDVWLLDLRVSILLPASKNEWNGDQVAQYDF
KAAIEQIQQATLASDVQCVVHCYGATTFFMSMLAGLQGVRSVVCSQIAADTVVATATGLK
AGLHLPGMLDAIGIKSLTAYADTKESWFNKLYDKALNGYARIEAQGYCTNPVCHRITFMY
ASLYRHDTLNETLHDNLHELFGESNIQTFEHLALIVRKGHLVDFKGNDVYMPHFDRLKLP
ICFISGADNQCYLPQSTLKTYERLCEMHGPQLFSRHEIPGYGHIDCMFGKDAVVDVYPII
LEHLEKTALG
NT seq 3453 nt NT seq  +upstreamnt  +downstreamnt
atgacacggatctcgacccccatcagtgatatccaggagcactacgacgtgatcgtcatc
ggttccggctacgggggcggcattgctgcctcacgcctgtcccgggccgggcgcaaggtg
tgcctgctggagcgtggccgggaaatccagcccggcgaataccccaataccctgctcgcg
gccaccgaggaactgcaagtccatgacccggatggccacatcggttcgcgcaccgggctg
ttcgacctgcatgtcaacgcccagcagaacgtggtggtcggttgtggcctgggcggcacg
tcgctgatcaatgccaacgtttcgctggagccggagcctggcgtgttcgaggacccgcgc
tggccccaggcggtccgtgagcaccaggacacgctgctcaaggacggctacgcccgggcc
cgggagatgctcaagcccaattcgtatccggcctcggagccgaacctgcccaagcttgac
gcgcacaaaaaatcggccgattacctcaagcaaggcgcgcatttctacaagccgccgatc
aacgtgactttcgacaagctgcccaacaacctcaaccacgtcggtgtcgaacagctgccg
tgcaatggttgtggcgattgcgtttcgggctgtaacaacaaggccaagaacaccacgctg
atgaactacctgccggatgcctggaaccacggcgcggagattttctgccaggccgaggtg
cggcacctggagcgcgacggcgatggttggatcgtgcacttccaatacctggacagcggt
cgcgagatgttctcggcgccgaccctgttcgtgcgcgccgacatcgtggtggtgtctgcc
ggcaccctgggctccaccgaaatcatgttgcgctcgcgggacaagggcctgtcgatgtcc
agccaattgggcgagaacatgagcggcaacggcgacattctcggcttcggccacaactgc
gaccaggtcatcaatggcatcggcttcggtgcccattcggccaaggaactggaaccggtg
gggccatgcatcacctcggtcatcgacatgcgcaccgagggtgactggcgcagccgcatg
gtcatcgaggaaggttctattcccggcgccctcggccgggccatggtgccgagcatggcg
gcgtttgccgaaatgatcggcgtgcccaccgacaccggcttcggcgccagcctcaagtac
aaggggcgcgaagccgagagctttttgcgcggcccctactacggcgcgctgcataacatg
cagacctatctgatcatgagccatgacaacggcaagggccgcatgctgctcgacaacaag
gaccagttgcgcatcgactggcccggcgtcggcgaacaggaaaacgtcacccttggcaac
gagcggctgcaccagagcaccaaggccctgggtgggatctgggtcgagaacccgatctgg
accaagctgctcaagcacagcatcgtctcggtccatcccctgggcggttgcgtgatgggc
gaggatgcgactcaaggcgtggtcaaccacaagggccaggtgtttagtggcgccagtggc
accgatgtctacccgggcctgtacgtgaccgacggttcggtgatcccgacgtcgttggcg
gtcaacccgctgctgaccatctcggcggtgagcgagcgcaacgtgggcctgctggcggct
gatcggggttggatcatcgactacacgctgccttcggccccgcgtaaagcggtggcggcg
ccgacacttggcgtgcagttcactgaaaccatgaagggctatttttccaccgccttcact
cagccccagggcaccgatctcagcctgtacgaagcggcggccaagcgcggcaagaccgac
aactcgcccatcgaattcacgctgaccatcaccgccgccgacctcaaccggatgatcaag
gaaccggaacacgccgcgaccctggtgggcaccctcgacgcaccgtcgctctcgtcgcag
ccgctggtcgccagcaatggggtattcaacctgttcgagcagtaccaggaacaggttggc
gtgcggcacatgaactacgacatgaagctaaccgccgaagacggcagcgactattacttc
agcgccttcaagacggtgcccgaggataacggtgtgctgaacatctggcacgacaccagt
accttgtacgtcaccctctatcgtgggccggacaagaccggcgcggtgatcggttcgggg
gtgatgcacattctgccggccgacttcgccaagcaaatgaccaccatgaaagtgctcaat
gcccgcaatgaacgtgaacgcgtggaggcgctggcgcggttcggcaagttctttgccggc
atcttgtgggagagctatggcggtgtcttcgccggcgacgtctacttcaacccggacgcg
ccgccccggttgaaacggccgttggatgcgccgccaccggtggtgcatttcttccagacc
gaagacaacgtcgagctgcgcctgacccgttaccaggccggcaccaaaggtccggtgatg
ttggtccatggcctgggcgtgggctctaatattttctccaccgacaccatccacaccaac
ttgctggaatacctctgcaagcacgaatacgacgtctggctgttggatttgcgggtgagc
atcctgctgccggccagcaaaaatgaatggaacggcgaccaggtggcccagtacgatttc
aaggccgccatcgagcagatccagcaggcgaccctggccagtgacgtgcagtgcgtagtg
cattgctacggtgcgacgacgttcttcatgtcgatgctggcgggtttgcagggcgtgcgt
tcggtggtctgctcacagatcgccgccgacacggtggtcgccactgctactgggctgaag
gccggtttgcatttgccggggatgctcgatgccatcggcatcaagtccctcacggcctac
gccgacaccaaggaaagctggttcaacaaactctacgacaaggccctcaacggctatgcc
cggatcgaggcccagggctactgcaccaacccggtctgccatcgcatcacgttcatgtat
gcctcgctgtaccgccacgacaccctcaacgaaaccctgcacgacaacctgcatgaattg
ttcggcgagtcgaacatccagaccttcgagcacttggcgctgatcgtgcgcaaggggcac
ctggtggacttcaagggcaacgacgtctacatgccgcatttcgatcggttgaaattgccg
atctgcttcatcagcggtgccgacaaccagtgctacttgccgcaaagcaccctcaagacc
tacgagcgactgtgcgagatgcacggcccgcagttgttcagccgtcacgagataccgggt
tacggccacatcgactgcatgttcggcaaggatgcggtggtggatgtgtatccgatcatc
ctcgagcacctggagaagacggcgctcggttga

DBGET integrated database retrieval system