KEGG   Pseudomonas brassicacearum: PSEBR_a5316Help
Entry
PSEBR_a5316       CDS       T01472                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pba  Pseudomonas brassicacearum
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:pba00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:pba00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6439061..6440065
Genome map
AA seq 334 aa AA seqDB search
MTPLETKRPLQLNDQGQLRHFLSLDGLRRELLTEILDTADSFLEVGARAVKKVPLLRGKT
VCNVFFENSTRTRTTFELAAQRLSADVITLNVSTSSASKGETLLDTLRNLEAMAADMFVV
RHGDSGAAHFIAEHVCPQVAIINGGDGRHAHPTQGMLDMLTIRRHKGSFENLSVAIVGDI
LHSRVARSNMLALKTLGCPDIRVIAPKTLLPIGVEQYGVKVYTDMTEGLKDVDVVIMLRL
QRERMTGGLLPSEGEFYRLFGLTTARLAGAKPDAIVMHPGPINRGVEIESAVADGPHSVI
LNQVTYGIAIRMAVLSMAMSGQTAQRQFDQENAQ
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgacgcctctcgaaaccaagcgcccgctgcagctcaacgatcagggccagctgcggcac
ttcctgtccctcgacggcctgcgccgcgagctgctgacggaaatcctcgacactgccgac
tcgtttctcgaagtcggtgcccgggcggtgaagaaagttccgttgctgcgcggcaagacc
gtgtgcaacgtgttcttcgaaaactccacccgcacccgcaccaccttcgaactggcggcc
caacggctgtcggcggacgtgatcaccctcaacgtgtccacgtcctcggcgagcaagggt
gaaaccctgctcgacaccctgcgcaacctcgaagccatggccgccgacatgttcgtcgtg
cgccacggcgactccggcgcggcgcacttcattgccgaacacgtctgcccgcaagtggcg
atcatcaacggcggcgacggccgtcacgcccacccgacccagggcatgctggacatgctg
accatccgtcggcacaagggcagcttcgaaaacctgtcggtggccatcgtcggcgacatc
ctgcactcgcgggtggcccgctcgaacatgctggccctcaagaccctcggctgcccggac
atccgcgtgatcgcgccgaaaaccctgctgcccatcggcgtcgagcaatacggcgtgaag
gtctacaccgacatgaccgaaggcctcaaggatgtggacgtggtgatcatgctgcgcctg
caacgcgagcgcatgaccggcggcctgctgcccagcgaaggcgagttctaccgcctgttc
ggcctgaccaccgcacgcctggccggggccaagccggacgctatcgtcatgcacccgggg
ccgatcaaccgcggcgtggagatcgagtcggcggtggccgacgggccgcactcggtgatt
ctcaaccaggtgacttacggcatcgccatccgcatggccgtgctgtccatggccatgagc
gggcaaacggcccagcgccaattcgaccaggagaacgcccagtga

DBGET integrated database retrieval system