KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a5523Help
Entry
PSEBR_a5523       CDS       T01472                                 

Definition
(GenBank) phosphomannomutase/phosphoglucomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Pathway
pba00010  Glycolysis / Gluconeogenesis
pba00030  Pentose phosphate pathway
pba00051  Fructose and mannose metabolism
pba00052  Galactose metabolism
pba00230  Purine metabolism
pba00500  Starch and sucrose metabolism
pba00520  Amino sugar and nucleotide sugar metabolism
pba00521  Streptomycin biosynthesis
pba01100  Metabolic pathways
pba01110  Biosynthesis of secondary metabolites
pba01120  Microbial metabolism in diverse environments
pba01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSEBR_a5523
   00030 Pentose phosphate pathway
    PSEBR_a5523
   00051 Fructose and mannose metabolism
    PSEBR_a5523
   00052 Galactose metabolism
    PSEBR_a5523
   00500 Starch and sucrose metabolism
    PSEBR_a5523
   00520 Amino sugar and nucleotide sugar metabolism
    PSEBR_a5523
  Nucleotide metabolism
   00230 Purine metabolism
    PSEBR_a5523
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PSEBR_a5523
Enzymes [BR:pba01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     PSEBR_a5523
    5.4.2.8  phosphomannomutase
     PSEBR_a5523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV DUF2218
Motif
Other DBs
NCBI-ProteinID: AEA72050
UniProt: F2K6X3
Position
6661241..6662638
Genome map
AA seq 465 aa AA seqDB search
MNTPAAIAPIFPDSIFRAYDIRGVVPETLTAETAYWIGRAIGSQSLAQGEPNVCVGRDGR
LSGPELVEQLIKGVADSGCQVSDVGLVPTPALYYAANVLAGKSGVMLTGSHNPSNYNGFK
IVIAGDTLANEQIQALHARLKTNDLSSGQGSVTKVDILARYNDEIVKDVKLARRLKVVVD
CGNGAAGVIAPQLIEALNCEVIPLFCDVDGNFPNHHPDPGKLENLEDLIAKVKETNADLG
LAFDGDGDRVGVVTNTGSVVFPDRLLMLFAKDVVARNPDAEIIFDVKCTRRLVPLIKEYG
GRPLMWKTGHSLIKKKMKQSGALLAGEMSGHIFFKERWFGFDDGIYSAARLLEILSKEKS
TAEELFATFPNDISTPEINIHVTEESKFSIIDALHDAQWGEGAELTTIDGVRVDYPHGWG
LVRASNTTPVLVLRFEADNEAELQRIKDVFHTQLKRVAPDLQLPF
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccccagccgcaatcgccccgatcttccctgacagcatcttccgcgcctacgac
atccgtggcgtggtaccggaaacccttaccgccgaaaccgcctactggatcggccgcgct
atcggctcccagagcctggcccagggcgaaccgaacgtgtgcgtcggccgtgatggccgc
ttgtcgggccccgagctggtcgaacaactgatcaaaggcgttgccgacagtggctgccaa
gtcagcgacgtgggcctggtgccgacccctgcgctgtactacgccgccaacgtgttggcc
ggcaagtccggggtgatgctcaccggcagccacaacccgtcgaactacaacggcttcaag
atcgtcatcgctggcgacaccctcgccaacgagcagatccaggccctgcacgcccgcctc
aagaccaatgacctgagcagcggccagggcagcgtgaccaaagtcgatatccttgcgcgc
tacaacgacgaaatcgtcaaggacgtgaaactcgcccgtcgcctgaaagtggtggtcgat
tgcggcaacggcgcggctggcgtgatcgccccgcaactgatcgaagccctgaactgcgaa
gtcatcccgctgttctgcgacgtggacggcaacttccctaaccaccacccggatccgggc
aagctggaaaacctcgaggacctgatcgccaaggtcaaggaaaccaacgccgacctgggc
ctggccttcgacggcgacggcgaccgcgtgggcgtggtgaccaataccggcagcgtggtg
ttcccggaccgcctgctgatgctgtttgccaaggacgtagtggcgcgcaaccccgacgcc
gagatcattttcgacgtcaaatgcacccgtcgcctggtgccgctgatcaaggaatatggc
ggtcgcccactgatgtggaaaaccggtcactcgttgatcaagaaaaaaatgaaacagagc
ggcgccctgctggccggcgaaatgagcggccacatcttcttcaaggaacgctggttcggt
tttgacgacggcatctacagcgccgcgcgcctgctggaaatcctcagcaaagagaaatcc
accgccgaagagctgttcgcaaccttcccgaacgatatttctacgccagaaatcaatatc
catgtgaccgaagagagcaaattcagcatcattgatgcactgcacgacgctcaatggggc
gaaggcgccgaactgaccaccatcgatggtgtgcgggtcgactatccccacggctggggc
ctggttcgcgcatccaacaccacaccggtgctggtactgcgtttcgaggccgacaacgag
gccgaactgcagcgcatcaaggatgtgttccacacccaactcaaacgtgttgcacctgat
ctccaactaccgttttga

DBGET integrated database retrieval system