KEGG   Pseudomonas brassicacearum: PSEBR_a5523Help
Entry
PSEBR_a5523       CDS       T01472                                 

Definition
phosphomannomutase/phosphoglucomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
pba  Pseudomonas brassicacearum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSEBR_a5523
   00030 Pentose phosphate pathway
    PSEBR_a5523
   00051 Fructose and mannose metabolism
    PSEBR_a5523
   00052 Galactose metabolism
    PSEBR_a5523
   00500 Starch and sucrose metabolism
    PSEBR_a5523
   00520 Amino sugar and nucleotide sugar metabolism
    PSEBR_a5523
  Nucleotide metabolism
   00230 Purine metabolism
    PSEBR_a5523
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PSEBR_a5523
Enzymes [BR:pba01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     PSEBR_a5523
    5.4.2.8  phosphomannomutase
     PSEBR_a5523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6661241..6662638
Genome map
AA seq 465 aa AA seqDB search
MNTPAAIAPIFPDSIFRAYDIRGVVPETLTAETAYWIGRAIGSQSLAQGEPNVCVGRDGR
LSGPELVEQLIKGVADSGCQVSDVGLVPTPALYYAANVLAGKSGVMLTGSHNPSNYNGFK
IVIAGDTLANEQIQALHARLKTNDLSSGQGSVTKVDILARYNDEIVKDVKLARRLKVVVD
CGNGAAGVIAPQLIEALNCEVIPLFCDVDGNFPNHHPDPGKLENLEDLIAKVKETNADLG
LAFDGDGDRVGVVTNTGSVVFPDRLLMLFAKDVVARNPDAEIIFDVKCTRRLVPLIKEYG
GRPLMWKTGHSLIKKKMKQSGALLAGEMSGHIFFKERWFGFDDGIYSAARLLEILSKEKS
TAEELFATFPNDISTPEINIHVTEESKFSIIDALHDAQWGEGAELTTIDGVRVDYPHGWG
LVRASNTTPVLVLRFEADNEAELQRIKDVFHTQLKRVAPDLQLPF
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccccagccgcaatcgccccgatcttccctgacagcatcttccgcgcctacgac
atccgtggcgtggtaccggaaacccttaccgccgaaaccgcctactggatcggccgcgct
atcggctcccagagcctggcccagggcgaaccgaacgtgtgcgtcggccgtgatggccgc
ttgtcgggccccgagctggtcgaacaactgatcaaaggcgttgccgacagtggctgccaa
gtcagcgacgtgggcctggtgccgacccctgcgctgtactacgccgccaacgtgttggcc
ggcaagtccggggtgatgctcaccggcagccacaacccgtcgaactacaacggcttcaag
atcgtcatcgctggcgacaccctcgccaacgagcagatccaggccctgcacgcccgcctc
aagaccaatgacctgagcagcggccagggcagcgtgaccaaagtcgatatccttgcgcgc
tacaacgacgaaatcgtcaaggacgtgaaactcgcccgtcgcctgaaagtggtggtcgat
tgcggcaacggcgcggctggcgtgatcgccccgcaactgatcgaagccctgaactgcgaa
gtcatcccgctgttctgcgacgtggacggcaacttccctaaccaccacccggatccgggc
aagctggaaaacctcgaggacctgatcgccaaggtcaaggaaaccaacgccgacctgggc
ctggccttcgacggcgacggcgaccgcgtgggcgtggtgaccaataccggcagcgtggtg
ttcccggaccgcctgctgatgctgtttgccaaggacgtagtggcgcgcaaccccgacgcc
gagatcattttcgacgtcaaatgcacccgtcgcctggtgccgctgatcaaggaatatggc
ggtcgcccactgatgtggaaaaccggtcactcgttgatcaagaaaaaaatgaaacagagc
ggcgccctgctggccggcgaaatgagcggccacatcttcttcaaggaacgctggttcggt
tttgacgacggcatctacagcgccgcgcgcctgctggaaatcctcagcaaagagaaatcc
accgccgaagagctgttcgcaaccttcccgaacgatatttctacgccagaaatcaatatc
catgtgaccgaagagagcaaattcagcatcattgatgcactgcacgacgctcaatggggc
gaaggcgccgaactgaccaccatcgatggtgtgcgggtcgactatccccacggctggggc
ctggttcgcgcatccaacaccacaccggtgctggtactgcgtttcgaggccgacaacgag
gccgaactgcagcgcatcaaggatgtgttccacacccaactcaaacgtgttgcacctgat
ctccaactaccgttttga

  All links  
No link information was found.   
DBGET integrated database retrieval system