KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a5530Help
Entry
PSEBR_a5530       CDS       T01472                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pba00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PSEBR_a5530
Enzymes [BR:pba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     PSEBR_a5530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6667611..6668231
Genome map
AA seq 206 aa AA seqDB search
MTHSTGTLYIISAPSGAGKTSLVKALIDAEPQIRVSVSHTTRAMRPGEVNGVNYHFVDRE
EFVKMAEHGDFLERAEVFGNLYGTSQSYLQQTLDEGHDLILEIDWQGAEQVRKLMPQARS
IFILPPSQQALRQRLTNRGQDSDDIIEGRMREAVSEMSHYVDYDYLIINDDFAHALDDLK
AIFRASQLQQKRQQQRFGKLLAELLG
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgacccacagcaccggcaccctctacatcatttccgcgccctcgggcgccggcaagacc
agcctggtcaaggcactgatcgacgccgaaccgcagatccgcgtctcggtctcgcacacc
acccgcgccatgcgcccgggcgaagtgaatggtgtgaactatcacttcgtcgaccgcgaa
gagttcgtgaagatggccgagcacggcgacttcctggagcgcgccgaagttttcggcaac
ctttatggcacttcgcaaagctacttgcagcagaccctggacgaaggtcacgacctgatc
ctggaaatcgactggcaaggcgccgagcaggtgcgcaagctgatgccccaggcccggtcg
atcttcatcctgccgccaagccagcaagccttgcgccagcgcctgaccaaccgtggccag
gacagcgacgacatcatcgagggccggatgcgcgaagcggtcagcgagatgagtcactac
gtcgactatgattatctgatcatcaacgacgatttcgcccacgcgctggacgacctgaag
gcgattttccgcgccagccagctgcagcagaaacgccaacagcaacgtttcggcaaatta
ttagccgaattgttgggctga

DBGET integrated database retrieval system