KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a5648Help
Entry
PSEBR_a5648       CDS       T01472                                 

Definition
glucosamine--fructose-6-phosphate aminotransferase
Orthology
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pba00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PSEBR_a5648
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PSEBR_a5648
Enzymes [BR:pba01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     PSEBR_a5648
Peptidases [BR:pba01002]
 Cysteine Peptidases
  Family C44
   PSEBR_a5648
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6822522..6824354)
Genome map
AA seq 610 aa AA seqDB search
MCGIVGAVAERNITAILLEGLKRLEYRGYDSAGVAVFTNDEKLERMRRPGKVSELEQALE
AEPLLGRLGIAHTRWATHGAPCERNAHPHFSGDLAVVHNGIIENHEALREQLKALGYVFT
SDTDTEVIAHLLNHKLKDLLDLTVALKATVKELHGAYGLAVISTKQPDRLVAARSGSPLV
IGLGLGENFLASDQLALRQVTDRFMYLEEGDIAEIRRDSVQIWDLDGKSVERETVQYRDG
AEAADKGEFRHFMLKEIHEQPAVVQRTLEGRMSQNQVLVQAFGPQAAELFAKVRNVQIVA
CGTSYHAGMVARYWLEELAGIPCQVEVASEFRYRKVVVQPDSLFVTISQSGETADTLAAL
RNAKELGFLASLAICNVGISSLVRESDLTLLTQAGREIGVASTKAFTTQLVGLLLLTLAL
GQVRGTLGKGVEAELVEELRRLPARLGEALAMDGTVEKIAELFAEKNHTLFLGRGAQFPV
AMEGALKLKEISYIHAEAYPAGELKHGPLALVDNDMPVVTVAPNNELLEKLKSNLQEVRA
RGGQLIVFADEKAGMTNGEGTHVVHMPHIHDILSPILYTIPLQLLSYYVAVLKGTDVDQP
RNLAKSVTVE
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattgtcggcgccgttgctgaacgcaacatcacagcaatcttgctcgaaggc
ctcaagcgcctggagtaccgcggttatgacagcgccggtgtggcggtgtttaccaacgac
gagaagctcgaacgcatgcgtcgtccgggcaaggtcagcgagctggagcaggcgctggaa
gccgaaccgctgctcggtcgcctgggcatcgcccacacccgctgggccacccatggcgcg
ccgtgcgagcgtaacgctcacccgcatttttccggcgacctggcggtggtgcacaacggc
atcatcgaaaaccacgaagccctgcgtgaacagctcaaggcgcttggctatgtgttcacc
tcggacaccgacactgaagtcattgcccatctgctcaatcacaagctcaaggacctgttg
gacctgaccgtcgccctcaaggccaccgtcaaggaactgcacggtgcctatggcctggcg
gtcatcagcacgaaacaacctgatcgcctggtggcagcccgcagcggcagcccattggtc
atcggcctcggcctgggggaaaacttcctggcttccgaccagttggcgctgcgccaggtc
accgaccgcttcatgtacctggaagaaggcgatatcgccgaaatccgccgcgacagcgtg
cagatctgggacctcgatggcaaaagtgtagagcgtgagaccgtccagtaccgcgacggt
gccgaagccgctgacaagggcgagttccgccacttcatgctcaaggaaatccacgaacaa
ccggccgtggtgcaacgcaccctggaaggccgcatgagccagaaccaggtgctggtccag
gcgttcggtccacaggcggccgagttgttcgccaaggtccgcaacgtgcagatcgtggcc
tgcggcaccagttatcacgccggcatggtcgcccgttactggttggaagaactggctggt
attccgtgccaggtcgaagtcgccagcgagttccgctatcgcaaagtggtggtgcaaccc
gattcgctgttcgtcaccatctcccagtccggcgaaaccgccgacaccctggccgccttg
cgcaacgccaaggaactgggtttcctcgccagcctggcgatctgcaacgtgggcatcagc
tcgctggtgcgcgaatccgacctgaccctgctgacccaggccggtcgtgagatcggcgtg
gcgtcgaccaaggcgttcactacgcaactggtggggttgctgttgctgacgctggccttg
ggccaagtgcgcggtacgctgggcaagggcgtcgaggccgaactggtggaagaactgcgt
cgcctgccggctcgcctgggcgaagccctggccatggacggtactgtggaaaaaatcgcc
gagctgttcgccgagaagaaccacaccctgttcctgggccgtggcgcgcaattcccggtg
gcgatggaaggggccttgaagctcaaggaaatctcctacatccacgccgaggcctacccg
gccggcgagctcaagcacggcccgctggcgcttgtggataacgacatgccggtggtcacc
gtcgcgccgaacaacgagctgctggaaaagctcaagtccaacctgcaggaagtgcgcgcc
cgtggcggccagttgattgtctttgccgacgaaaaggctggcatgaccaatggcgaaggc
acccacgtggtgcacatgccacacatccacgacatcctgtcgccgattctctacaccatc
ccgctgcaactgctgtcgtactacgtcgcggtgctcaaggggactgatgtggaccagccg
cgtaacctggcgaaatctgtgacggtggagtga

DBGET integrated database retrieval system