KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a5648Help
Entry
PSEBR_a5648       CDS       T01472                                 

Definition
(GenBank) putative glucosamine--fructose-6-phosphate aminotransferase
  KO
K00820  glucosamine---fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Pathway
pba00250  Alanine, aspartate and glutamate metabolism
pba00520  Amino sugar and nucleotide sugar metabolism
pba01100  Metabolic pathways
pba01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pba00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PSEBR_a5648
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PSEBR_a5648
Enzymes [BR:pba01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     PSEBR_a5648
Peptidases [BR:pba01002]
 Cysteine Peptidases
  Family C44
   PSEBR_a5648
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SIS GATase_6 GATase_7 GATase_4 SIS_2
Motif
Other DBs
NCBI-ProteinID: AEA72189
UniProt: F2K7B2
Position
complement(6822522..6824354)
Genome map
AA seq 610 aa AA seqDB search
MCGIVGAVAERNITAILLEGLKRLEYRGYDSAGVAVFTNDEKLERMRRPGKVSELEQALE
AEPLLGRLGIAHTRWATHGAPCERNAHPHFSGDLAVVHNGIIENHEALREQLKALGYVFT
SDTDTEVIAHLLNHKLKDLLDLTVALKATVKELHGAYGLAVISTKQPDRLVAARSGSPLV
IGLGLGENFLASDQLALRQVTDRFMYLEEGDIAEIRRDSVQIWDLDGKSVERETVQYRDG
AEAADKGEFRHFMLKEIHEQPAVVQRTLEGRMSQNQVLVQAFGPQAAELFAKVRNVQIVA
CGTSYHAGMVARYWLEELAGIPCQVEVASEFRYRKVVVQPDSLFVTISQSGETADTLAAL
RNAKELGFLASLAICNVGISSLVRESDLTLLTQAGREIGVASTKAFTTQLVGLLLLTLAL
GQVRGTLGKGVEAELVEELRRLPARLGEALAMDGTVEKIAELFAEKNHTLFLGRGAQFPV
AMEGALKLKEISYIHAEAYPAGELKHGPLALVDNDMPVVTVAPNNELLEKLKSNLQEVRA
RGGQLIVFADEKAGMTNGEGTHVVHMPHIHDILSPILYTIPLQLLSYYVAVLKGTDVDQP
RNLAKSVTVE
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattgtcggcgccgttgctgaacgcaacatcacagcaatcttgctcgaaggc
ctcaagcgcctggagtaccgcggttatgacagcgccggtgtggcggtgtttaccaacgac
gagaagctcgaacgcatgcgtcgtccgggcaaggtcagcgagctggagcaggcgctggaa
gccgaaccgctgctcggtcgcctgggcatcgcccacacccgctgggccacccatggcgcg
ccgtgcgagcgtaacgctcacccgcatttttccggcgacctggcggtggtgcacaacggc
atcatcgaaaaccacgaagccctgcgtgaacagctcaaggcgcttggctatgtgttcacc
tcggacaccgacactgaagtcattgcccatctgctcaatcacaagctcaaggacctgttg
gacctgaccgtcgccctcaaggccaccgtcaaggaactgcacggtgcctatggcctggcg
gtcatcagcacgaaacaacctgatcgcctggtggcagcccgcagcggcagcccattggtc
atcggcctcggcctgggggaaaacttcctggcttccgaccagttggcgctgcgccaggtc
accgaccgcttcatgtacctggaagaaggcgatatcgccgaaatccgccgcgacagcgtg
cagatctgggacctcgatggcaaaagtgtagagcgtgagaccgtccagtaccgcgacggt
gccgaagccgctgacaagggcgagttccgccacttcatgctcaaggaaatccacgaacaa
ccggccgtggtgcaacgcaccctggaaggccgcatgagccagaaccaggtgctggtccag
gcgttcggtccacaggcggccgagttgttcgccaaggtccgcaacgtgcagatcgtggcc
tgcggcaccagttatcacgccggcatggtcgcccgttactggttggaagaactggctggt
attccgtgccaggtcgaagtcgccagcgagttccgctatcgcaaagtggtggtgcaaccc
gattcgctgttcgtcaccatctcccagtccggcgaaaccgccgacaccctggccgccttg
cgcaacgccaaggaactgggtttcctcgccagcctggcgatctgcaacgtgggcatcagc
tcgctggtgcgcgaatccgacctgaccctgctgacccaggccggtcgtgagatcggcgtg
gcgtcgaccaaggcgttcactacgcaactggtggggttgctgttgctgacgctggccttg
ggccaagtgcgcggtacgctgggcaagggcgtcgaggccgaactggtggaagaactgcgt
cgcctgccggctcgcctgggcgaagccctggccatggacggtactgtggaaaaaatcgcc
gagctgttcgccgagaagaaccacaccctgttcctgggccgtggcgcgcaattcccggtg
gcgatggaaggggccttgaagctcaaggaaatctcctacatccacgccgaggcctacccg
gccggcgagctcaagcacggcccgctggcgcttgtggataacgacatgccggtggtcacc
gtcgcgccgaacaacgagctgctggaaaagctcaagtccaacctgcaggaagtgcgcgcc
cgtggcggccagttgattgtctttgccgacgaaaaggctggcatgaccaatggcgaaggc
acccacgtggtgcacatgccacacatccacgacatcctgtcgccgattctctacaccatc
ccgctgcaactgctgtcgtactacgtcgcggtgctcaaggggactgatgtggaccagccg
cgtaacctggcgaaatctgtgacggtggagtga

DBGET integrated database retrieval system