KEGG   Pseudomonas brassicacearum: PSEBR_a684Help
Entry
PSEBR_a684        CDS       T01472                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pba  Pseudomonas brassicacearum
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pba03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
857164..859260
Genome map
AA seq 698 aa AA seqDB search
MSRSFADLLPKSSDDESLVELAPLSRAQDLLLLLTRWVERGWLRALDKAFVAFLHELAPD
DDPLVLLAAALTSHQLGHGHVCLDVFETLKEPDFALSLPPEGDLQTGVMLLPSQILATLD
GVHWCKVLASSRLVALAVDGSEEAQQRPLVLSGKRLYLRRYWGYERRIDEALRQRLIEHE
AAPGDLRERLDGLFGPANASGPIDWQKLACALATRGSFSIVTGGPGTGKTTTVVRLLALL
QAPAVEAGKPLRIRLAAPTGKAAARLTESISQQVRTLDVDDAVRERIPCDVTTVHRLLGS
RPGTRHFRHHAGNRLPLDVLVVDEASMIDLEMMANLLDALPAHARLVLLGDKDQLASVEA
GAVLGDLCRDAEEGWYSPRTRAWLESVSGENLAAGDLQQDLDGTHPLAQQVVMLRHSRRF
GEGSGIGQLARWVNQQQPEKARQLLEQGQHADLSSLKLANEHDTKLEKLLLDGKPDGSQG
YRHYLNLLRQRRPAISRSLEDRCWTDWAREVLAAFDEFQLLCAVRKGPWGVEGLNLRITA
ALLKARLIDSDHQWYEGRPVLMTRNDYGLGLMNGDIGIALKLPERDGPDAGKQVLRVAFP
RNDGQGGVRFVLPSRLNDVETVYAMTVHKSQGSEFTHTALILPDALNPVLTKELVYTAIT
RGKQWFSLIEPRAGVFEEAVRRKVKRLSGLMLELEGDD
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgttcttttgccgacctgctgcccaagtcgtccgacgacgaaagcctggtggag
ttggcgcccttgagccgtgcgcaggacctgctgttgttactgacgcgctgggtcgagcgc
ggctggttgcgcgccctggacaaggccttcgtggcgttcctccatgaactggcacccgac
gatgatccattggtcctgctcgccgctgcgttgaccagtcatcaactgggtcacgggcat
gtttgcctggatgtgttcgagaccctcaaggaaccggattttgctctgtccctgcctccc
gagggtgacctgcagacgggtgtgatgctgctgccatcgcaaatattggcgacactggac
ggcgtccattggtgcaaggtcctggcgtccagtcgtctggtggccctggccgtggatggg
agcgaagaggcgcagcaacgtccgttggtgctgtctggcaaacgtctttatctgcgccgc
tactggggttatgaacggcggatcgatgaagcgttgcgtcaacggcttatcgagcatgaa
gcggcgcccggcgacctgcgcgagcgtttggacgggttgttcgggccggccaatgccagc
ggcccgatcgattggcagaaactggcctgcgcgctggcaacccgcgggtccttcagcatc
gtgaccggcggcccgggcaccggcaagaccacgaccgttgtgcgcctgctggccctgctc
caggcaccggccgtcgaggccgggaagccgctgcggattcgcctggccgcgcccactggc
aaggcggcggcgcgcctgaccgagtccatcagccagcaggtccggaccctggatgtggac
gacgcggtgcgcgaacggattccctgcgacgtcacgacagtccatcgtttgctgggcagc
cgccctggcacccggcattttcgccaccatgcaggcaatcgcttgccactggatgtgttg
gtggtcgatgaagcgtcgatgatcgacctggagatgatggccaatctgctggatgctctg
ccggcccatgcacggttggtattgctgggggacaaggaccagttggcctctgtagaagcc
ggtgcggtgctcggggatttgtgtcgagacgccgaggagggctggtacagcccccggacc
cgagcctggcttgagtcggtcagcggtgaaaacctggcggccggtgacctgcaacaggac
ctcgacggcactcatcccctggcacagcaagtggtcatgctcaggcattcccggcgcttc
ggcgaaggcagcgggatcggtcagctggctcgctgggtcaaccagcagcagcctgaaaaa
gcccgtcagttgctggagcaagggcagcatgccgatctgtcttccctgaagttggcgaat
gaacacgacacgaaactggagaagctgttactcgacggcaagccagatgggtcccagggg
tatcggcattacctgaacctgctacggcagcgacgcccggccatttctcgctcgctggaa
gaccgttgctggaccgattgggcccgggaagtcctggcggccttcgacgaattccaattg
ctttgcgcggtgcgcaaaggtccgtggggcgtcgaaggactgaacctgcgaatcaccgcc
gccttgctcaaggcacgccttatcgatagcgatcatcagtggtacgaaggacgcccggtg
ctgatgacccgcaacgactatgggctggggctgatgaacggcgatatcggtatcgccctc
aagttgcccgagcgtgacgggcctgatgctggaaaacaggttctgcgggtcgctttcccg
cgcaacgacggtcagggcggtgtgcgtttcgtcctgcccagccgcctgaatgatgtggaa
accgtgtatgccatgacggtgcacaaatcccagggctcggaattcacccataccgcgttg
attctcccggatgcgctgaacccggtattgaccaaggagttggtgtacaccgccattact
cggggcaagcaatggttcagcctgatagagccgcgagcgggggtgtttgaggaggcggtg
cggcgcaaggtcaagcgcttgagcgggctgatgttggaactggagggtgatgactga

DBGET integrated database retrieval system