KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a684Help
Entry
PSEBR_a684        CDS       T01472                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pba00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PSEBR_a684
Enzymes [BR:pba01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     PSEBR_a684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
857164..859260
Genome map
AA seq 698 aa AA seqDB search
MSRSFADLLPKSSDDESLVELAPLSRAQDLLLLLTRWVERGWLRALDKAFVAFLHELAPD
DDPLVLLAAALTSHQLGHGHVCLDVFETLKEPDFALSLPPEGDLQTGVMLLPSQILATLD
GVHWCKVLASSRLVALAVDGSEEAQQRPLVLSGKRLYLRRYWGYERRIDEALRQRLIEHE
AAPGDLRERLDGLFGPANASGPIDWQKLACALATRGSFSIVTGGPGTGKTTTVVRLLALL
QAPAVEAGKPLRIRLAAPTGKAAARLTESISQQVRTLDVDDAVRERIPCDVTTVHRLLGS
RPGTRHFRHHAGNRLPLDVLVVDEASMIDLEMMANLLDALPAHARLVLLGDKDQLASVEA
GAVLGDLCRDAEEGWYSPRTRAWLESVSGENLAAGDLQQDLDGTHPLAQQVVMLRHSRRF
GEGSGIGQLARWVNQQQPEKARQLLEQGQHADLSSLKLANEHDTKLEKLLLDGKPDGSQG
YRHYLNLLRQRRPAISRSLEDRCWTDWAREVLAAFDEFQLLCAVRKGPWGVEGLNLRITA
ALLKARLIDSDHQWYEGRPVLMTRNDYGLGLMNGDIGIALKLPERDGPDAGKQVLRVAFP
RNDGQGGVRFVLPSRLNDVETVYAMTVHKSQGSEFTHTALILPDALNPVLTKELVYTAIT
RGKQWFSLIEPRAGVFEEAVRRKVKRLSGLMLELEGDD
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgttcttttgccgacctgctgcccaagtcgtccgacgacgaaagcctggtggag
ttggcgcccttgagccgtgcgcaggacctgctgttgttactgacgcgctgggtcgagcgc
ggctggttgcgcgccctggacaaggccttcgtggcgttcctccatgaactggcacccgac
gatgatccattggtcctgctcgccgctgcgttgaccagtcatcaactgggtcacgggcat
gtttgcctggatgtgttcgagaccctcaaggaaccggattttgctctgtccctgcctccc
gagggtgacctgcagacgggtgtgatgctgctgccatcgcaaatattggcgacactggac
ggcgtccattggtgcaaggtcctggcgtccagtcgtctggtggccctggccgtggatggg
agcgaagaggcgcagcaacgtccgttggtgctgtctggcaaacgtctttatctgcgccgc
tactggggttatgaacggcggatcgatgaagcgttgcgtcaacggcttatcgagcatgaa
gcggcgcccggcgacctgcgcgagcgtttggacgggttgttcgggccggccaatgccagc
ggcccgatcgattggcagaaactggcctgcgcgctggcaacccgcgggtccttcagcatc
gtgaccggcggcccgggcaccggcaagaccacgaccgttgtgcgcctgctggccctgctc
caggcaccggccgtcgaggccgggaagccgctgcggattcgcctggccgcgcccactggc
aaggcggcggcgcgcctgaccgagtccatcagccagcaggtccggaccctggatgtggac
gacgcggtgcgcgaacggattccctgcgacgtcacgacagtccatcgtttgctgggcagc
cgccctggcacccggcattttcgccaccatgcaggcaatcgcttgccactggatgtgttg
gtggtcgatgaagcgtcgatgatcgacctggagatgatggccaatctgctggatgctctg
ccggcccatgcacggttggtattgctgggggacaaggaccagttggcctctgtagaagcc
ggtgcggtgctcggggatttgtgtcgagacgccgaggagggctggtacagcccccggacc
cgagcctggcttgagtcggtcagcggtgaaaacctggcggccggtgacctgcaacaggac
ctcgacggcactcatcccctggcacagcaagtggtcatgctcaggcattcccggcgcttc
ggcgaaggcagcgggatcggtcagctggctcgctgggtcaaccagcagcagcctgaaaaa
gcccgtcagttgctggagcaagggcagcatgccgatctgtcttccctgaagttggcgaat
gaacacgacacgaaactggagaagctgttactcgacggcaagccagatgggtcccagggg
tatcggcattacctgaacctgctacggcagcgacgcccggccatttctcgctcgctggaa
gaccgttgctggaccgattgggcccgggaagtcctggcggccttcgacgaattccaattg
ctttgcgcggtgcgcaaaggtccgtggggcgtcgaaggactgaacctgcgaatcaccgcc
gccttgctcaaggcacgccttatcgatagcgatcatcagtggtacgaaggacgcccggtg
ctgatgacccgcaacgactatgggctggggctgatgaacggcgatatcggtatcgccctc
aagttgcccgagcgtgacgggcctgatgctggaaaacaggttctgcgggtcgctttcccg
cgcaacgacggtcagggcggtgtgcgtttcgtcctgcccagccgcctgaatgatgtggaa
accgtgtatgccatgacggtgcacaaatcccagggctcggaattcacccataccgcgttg
attctcccggatgcgctgaacccggtattgaccaaggagttggtgtacaccgccattact
cggggcaagcaatggttcagcctgatagagccgcgagcgggggtgtttgaggaggcggtg
cggcgcaaggtcaagcgcttgagcgggctgatgttggaactggagggtgatgactga

DBGET integrated database retrieval system