KEGG   Pseudomonas brassicacearum: PSEBR_a774Help
Entry
PSEBR_a774        CDS       T01472                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
pba  Pseudomonas brassicacearum
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pba00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
999511..1000362
Genome map
AA seq 283 aa AA seqDB search
MTSVQSSTRLPCGNRVLDLAHAHVMGILNVTPDSFSDGGRFSQLDAALRHAEAMVVAGAT
LIDVGGESTRPGARAVSPTEELERVAPIVERIHRELDVIISVDTSTPAVMRETARLGAGL
INDVRSLRRDGALDAAAATGLPVCLMHMLGEPGTMQNDPHYDDVTREVGEFLVERLDQCV
AAGIPAERIILDPGFGFAKTLAHNLSLFKHMEALHALGRPLLVGVSRKSMIGNALGRPVG
ERLYGGLALAALALAKGARILRVHDVAETMDVVRMIAAVDSAE
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgacttctgttcagtcctcgacccggttgccttgcggcaaccgggttcttgatttggcc
catgcgcatgtcatgggcattctcaatgtcacgcctgattccttttccgatggtggtcga
ttcagccagctcgatgctgcgctgcggcacgccgaggccatggtggtcgcgggcgcaacg
ctgattgatgtgggtggtgaatcgacccggccgggcgcgcgtgcggtctcgccgaccgaa
gagctggagcgagtggcgccgattgtcgagcgtatccatcgcgaacttgatgtcattatc
tccgtcgatacgtccacgcctgcggtcatgcgtgagactgcgcgactgggggcgggcttg
atcaatgatgttcgatccctgcggcgcgatggtgccctggacgctgcggcggccaccggg
ttgccggtgtgcctgatgcatatgctcggcgagccggggaccatgcagaatgacccgcac
tatgatgatgtgaccagggaggtgggtgaattcctggtggagcgtctggaccagtgtgtc
gccgcgggcattcccgccgagcggatcatccttgaccctgggttcggctttgccaagacc
ctggctcacaacctgagcctgttcaagcatatggaagccttgcatgccttggggcggccc
ctgttggttggggtctcgcgaaagagcatgataggcaatgccttgggccgcccggtgggc
gaacgcctgtatggcggtctcgcgctggctgccttggcccttgccaagggcgcgcgtata
ttgcgcgtgcacgatgtagccgaaacgatggatgtcgtgcggatgatcgcagctgtggat
tcagccgaataa

DBGET integrated database retrieval system