KEGG   Pseudomonas brassicacearum: PSEBR_a776Help
Entry
PSEBR_a776        CDS       T01472                                 

Definition
Triose-phosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pba  Pseudomonas brassicacearum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSEBR_a776
   01230 Biosynthesis of amino acids
    PSEBR_a776
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSEBR_a776
   00051 Fructose and mannose metabolism
    PSEBR_a776
   00562 Inositol phosphate metabolism
    PSEBR_a776
Enzymes [BR:pba01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PSEBR_a776
Exosome [BR:pba04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PSEBR_a776
  Exosomal proteins of bladder cancer cells
   PSEBR_a776
  Exosomal proteins of melanoma cells
   PSEBR_a776
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1001795..1002538
Genome map
AA seq 247 aa AA seqDB search
MVAGNWKMHGTRASVAELINGLRHLALPSGVDVAVFPPCLFINQVIDGLKGKSISVGAQN
SAVESMQGALTGEIAPSQLLDAGCSLVLVGHSERRQIMGEQDKTLIRKFAAAQGCGLIPV
LCVGETLEQREAGKTLEVVGRQLGSIIEDLGVGAFAKAIIAYEPVWAIGTGLTASPQQAQ
DVHAAIRAQLAAENSEVARGVRLLYGGSVKAANAVELFGMPDIDGGLIGGASLNADEFGA
ICRAAGN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggtagctggtaactggaagatgcacggtacccgcgccagcgtcgctgagctgatcaat
ggccttcgtcatctggccttgccaagcggtgttgatgttgcggtattcccgccttgcctg
tttatcaatcaagtgattgatggcttgaaaggcaaatcgatttcggtcggtgcgcagaat
tctgcggtggaatccatgcaaggtgcgctgactggtgaaattgcgccgagtcagttgctg
gatgcaggttgctccctggtcctggtcgggcattccgagcgtcgccagatcatgggcgag
caggacaagaccttgatccgcaagtttgctgcggcccagggctgtggtctgattccggtg
ttgtgcgtaggggaaaccctcgagcagcgtgaagccggcaagacccttgaagttgtcggg
cgtcagctgggcagcatcatcgaagacctgggtgtcggtgcttttgcaaaggcaatcatt
gcttacgagccagtctgggccattggcaccgggctgactgcttcgccgcaacaggcgcag
gatgtgcacgcagccatccgcgcacagttggcggcagagaattctgaagtggcacgaggt
gtgcggcttctatacggcggcagcgtgaaggcggccaatgcggtcgaactgttcggcatg
ccggatatcgatggggggctcattggtggagcgtccctgaatgcagatgagttcggtgcg
atttgtcgcgccgcgggaaactga

DBGET integrated database retrieval system