KEGG   Pseudomonas brassicacearum: PSEBR_a794Help
Entry
PSEBR_a794        CDS       T01472                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
pba  Pseudomonas brassicacearum
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pba00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:pba00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:pba02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1028517..1030058
Genome map
AA seq 513 aa AA seqDB search
MSEFDLGRRRVMQAVGAGLLLPGLAPAVMASVKDRPVLTDGVQSGDLQGDRAMIWSRSDR
PARMVVEWDTRSKFSNPRRFVSPMVDARSDFTARVELTGLPRDQAIFYRVHFEDAQSGVA
SEPWLGHLRSVPQFKRNIRFVWSGDTVGQGFGINPDIGGMRIYEAMRLRLPDFFIHSGDT
IYADGPVPAQITTEGGRIWRNLTTEAKSKVAETLDEYRGNYRYNLMDENVRRFNAEVPQI
WQWDDHEVVNNWSPGKQLDERYQTKDIHSLVGRARQAWLEYAPMRLQKADGGGRIYRKLG
YGPLLDVFVLDMRSYREANDANLGAAKPFLGREQLNWLKRELKQSRAQWKVIAADMPIGL
GVPDGEVSPGVPRWEAVANGDPGAAQGRELEIAELLGYLRKHQVRNYVWLTADVHYCAAH
HYHPEQAAFQDFEPFWEFVAGPLNAGSFGPNALDKTFGPEVVFQKAPPAQNTSPFAGYQF
FGEVNIDGPSGEMSVVLRDLEGVAVFEKKLQPV
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaattcgacctgggccgccgtcgtgtgatgcaagccgtgggggcggggttgttg
ttgccggggctggcgccggcggtgatggcttcggtcaaggatcggccggtgctcaccgac
ggtgtgcagtctggcgacttgcagggcgaccgggcgatgatctggagccgcagcgaccgt
ccggcgcggatggtggtggagtgggacacccgcagcaagttcagcaatccccgccgcttc
gtctcgcccatggtcgacgcccgcagcgatttcactgcccgggtcgaactcaccgggctg
ccccgcgaccaggcgattttctaccgggtgcatttcgaagacgcccagagcggtgtcgcc
agcgaaccctggctgggtcacctgcgcagcgtgccgcagttcaagcgcaacatccgtttt
gtctggagcggcgataccgtcggccagggcttcggcatcaacccggacatcggcggcatg
cgcatctacgaagccatgcgcctgcgtctgccggatttctttatccacagcggcgacacc
atctacgccgacggcccggtgccggcgcaaatcaccaccgagggtggacgcatctggcgc
aacctcaccaccgaagccaagagcaaggtcgccgagaccctggatgagtatcgcggcaac
tatcgctacaacctgatggacgaaaacgttcgtcgcttcaacgccgaagtgccgcagatc
tggcagtgggacgaccatgaggtggtcaacaactggtcgccgggcaagcaactggacgag
cgctaccagaccaaggatatccacagcctcgtggggcgcgcgcgacaagcctggctggaa
tacgcgccgatgcgtctgcagaaggccgacggcggcggacggatctaccgcaagctcggt
tacgggccgctgctggatgtgttcgtgctggacatgcgcagctaccgcgaagccaacgac
gccaacctcggcgcggccaagccgttcctggggcgtgagcagttgaattggctcaagcgt
gaattgaagcaatcccgtgcccaatggaaagtcatcgccgccgacatgcccatcggcctc
ggtgtgccggatggcgaggtcagccccggcgtgccgcgctgggaagcggtcgccaacggt
gacccgggcgcggcccaggggcgtgaactggagatcgccgaactgctcggctacctgcgc
aagcatcaggtgcgcaactacgtctggctcaccgccgatgtccactattgcgccgcccat
cattaccatcctgaacaagccgcgttccaggatttcgaaccgttctgggagtttgtcgcc
gggccgttgaacgccggcagcttcgggcccaatgccctggacaagaccttcggccccgaa
gtggtgttccagaaagctccgccggcccagaacacctcgccgtttgccgggtatcagttc
tttggcgaggtgaacatcgacgggccaagcggggagatgagcgtggtgctgcgggatctg
gaaggtgtggcggtgttcgagaagaagttgcagccggtttga

DBGET integrated database retrieval system