KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a860Help
Entry
PSEBR_a860        CDS       T01472                                 

Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Pathway
pba00340  Histidine metabolism
pba01100  Metabolic pathways
pba01110  Biosynthesis of secondary metabolites
pba01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pba00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    PSEBR_a860
Enzymes [BR:pba01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     PSEBR_a860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AEA67026
UniProt: F2KCH3
Position
1104235..1105572
Genome map
AA seq 445 aa AA seqDB search
MTAPTSIRRLNAADPDFAHHLDHLLSWESVSDDSVNQRVLDIIKAVRERGDAALVEFTQK
FDGLQVASMADLILPRERLELALTRITVPQREALEKAASRVRDYHERQKQDSWSYTEADG
TVLGQKVTPLDRAGLYVPGGKASYPSSVLMNAIPAKVAGVTEVVMVVPTPRGEINELVLA
AACIAGVDRVFTIGGAQAVAALAYGTESVPRVDKVVGPGNIYVATAKRHVFGQVGIDMIA
GPSEILVVCDGQTDPDWIAMDLFSQAEHDEDAQAILVSPDAEFLDKVAASIDKLLPTMDR
AEIINTSINGRGALIKVRDMEQAIEVANRIAPEHLELSVADPQAWLPQIRHAGAIFMGRH
TSEALGDYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSIIFCSEQGASELGKTASVLARG
ESLSAHARSAEYRILDENSIEGQGN
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctcccacttcgattcgccgactcaatgctgccgacccggatttcgcacatcat
ctggatcatctgctgagctgggaaagcgtgtctgacgactcggtcaatcagcgggtgctg
gacatcatcaaggctgtgcgcgagcgtggcgatgctgccctggtggaattcacccagaag
ttcgacggcctgcaagtggcgtccatggccgacctgatcctgccgcgcgagcgactggaa
ctggccctgacccggatcaccgtgccccagcgcgaagccttggaaaaggccgcgtcccga
gtgcgcgactatcacgaaaggcagaaacaggactcctggagctacaccgaagccgacggc
accgtgctgggccagaaggtcacgccgctggaccgcgccggcctgtacgtgccgggtggc
aaggcgtcctatccgtcctcggtgctgatgaacgccatcccggccaaggttgccggcgtg
accgaagtggtcatggtcgtcccgaccccgcgcggtgaaatcaacgaactggtgctggcc
gccgcttgcatcgctggtgtggaccgggtgttcaccatcggcggtgcccaggccgtggct
gcgctggcctatggcaccgaaagcgtgccgcgggtcgacaaggtggtcgggccgggcaac
atctatgtcgccaccgccaagcgccacgtgtttggccaggtcggcatcgacatgatcgcc
ggcccttcggaaatcctcgtggtgtgcgacggccagaccgacccggactggatcgccatg
gacctgttttcccaggccgagcacgacgaagacgcccaggcgatcctggtcagcccggac
gccgagttcctcgacaaggtcgccgccagcatcgacaagctgctgccaaccatggaccgc
gccgagatcatcaatacgtcgatcaatggccgtggcgcgctgatcaaggtccgcgacatg
gagcaggccatcgaagtcgccaaccgtatcgcgccggaacacctggaattgtcggtcgcc
gacccgcaggcctggctgccgcagatccgtcacgccggtgcgatcttcatgggtcgtcac
accagtgaggccctgggcgactattgcgcaggccccaaccacgtgttgccgacttccggc
accgcgcgcttctcgtcgccgttgggggtgtatgacttccagaaacgctcgtcgatcatc
ttctgctccgagcagggcgcctccgaactgggcaagaccgcttcggtgctggcccgtggc
gaatcgctgagcgcccacgcccgcagcgccgagtaccgcattcttgacgaaaactccatt
gaaggtcaggggaactga

DBGET integrated database retrieval system