KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a995Help
Entry
PSEBR_a995        CDS       T01472                                 

Definition
protein disulfide isomerase II
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Brite
Enzymes [BR:pba01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PSEBR_a995
Secretion system [BR:pba02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PSEBR_a995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1263725..1264456
Genome map
AA seq 243 aa AA seqDB search
MRLIQMFTAAAIALASTFAIADDAADKAIRKSLENLQLEVPIETISASPMAGLYEIKLKG
SRVLYASADGQYIVQGNLFELKDGKPVNLTEMTERQGISKLINGIPVAETVVYPAIGETK
SHITVFTDTTCPYCHKLHAEVPELNKRGIEVRYVAFPRQGLGSPGDEQLQAVWCSKDKKA
AMDKMVDGKEIKAAKCENPVSKQFALGQSIGVNGTPAIVLADGQVIPGYQPAPQVAKLAL
GAK
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttgatccagatgttcaccgccgccgccattgcgctggccagtacctttgccatc
gccgacgacgcggccgacaaggctatccgcaagagcctggaaaaccttcagctcgaagtg
ccgatcgaaaccatctcggccagtcccatggccggcctgtatgagatcaagctcaagggc
agccgcgtgctttacgccagcgccgacggtcagtacatcgtccagggcaacctgttcgag
ctcaaggacggcaagccggtcaatctcaccgagatgaccgagcgccagggcatttccaag
ttgatcaacggcattccagtcgctgaaaccgtggtctatccggcgattggcgaaaccaag
tcgcacatcaccgtgttcactgacaccacctgcccgtattgccacaagctgcacgccgaa
gtgccggagctgaacaagcgcggcatcgaagtgcgctatgttgcgttcccgcgccagggc
ctgggctcgccgggcgatgagcagttgcaggcggtctggtgctccaaggacaagaaagcg
gccatggacaagatggtcgatggcaaggaaatcaaggccgccaagtgcgagaacccggtt
tccaagcagttcgcccttggccagtccattggagtgaacggcacgccggccatcgttttg
gctgacggccaggtgattccgggctaccagccggcgccacaagtcgccaaactggccctg
ggcgcaaaatga

DBGET integrated database retrieval system