KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a997Help
Entry
PSEBR_a997        CDS       T01472                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pba00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PSEBR_a997
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PSEBR_a997
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PSEBR_a997
Enzymes [BR:pba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PSEBR_a997
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1265999..1267408
Genome map
AA seq 469 aa AA seqDB search
MRYISTRGQAPALNFEDVLLAGLATDGGLYVPENLPRFTQEEIASWAGLPYHELAFRVMR
PFVTGSIPDADFKKILEETYGVFSHNAIAPLRQLNGNEWVMELFHGPTLAFKDFALQLLG
RLLDYVLQKRGERVVIVGATSGDTGSAAIEGCKHCENVDIFILHPHNRVSEVQRRQMTTI
FGDNIHNIAIEGNFDDCQEMVKASFADQSFLKGTRLVAVNSINWARIMAQIVYYFHAALQ
LGGPARSVSFSVPTGNFGDIFAGYLARNMGLPINQLIVATNRNDILHRFMSGNQYVKETL
HATLSPSMDIMVSSNFERLLFDLHGRNGAAIAGLMDSFRQGGGFSVEPERWTEARKLFDS
LAVDDEQTCETIAEVFEQSGELLDPHTAIGVRAARECRRSLDIPMVILGTAHPVKFPEAV
EKAGVGKALELPAHLSDLFERDERCTVLPNDLKAVQAFVSQHGNRGKPL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcgctatatcagcacccgcggccaggcaccggccctgaatttcgaagatgtcctcctg
gccggcctggccacggacggcggtctctatgtgccggaaaacctgccgcgcttcacccag
gaagaaatcgcttcctgggccggcctgccgtatcacgagctggcgttccgggtcatgcgc
ccgttcgtcaccggcagcatcccggacgccgatttcaagaaaatcctcgaagagacctat
ggcgtcttttcccacaacgccatcgcaccgctgcgtcagctcaacggtaacgaatgggtc
atggagctgttccacggccccaccctggcgttcaaggacttcgccctgcaattgctcggt
cgcctgctggactacgtgctgcaaaagcgtggcgagcgtgtggtgatcgtcggtgccact
tctggcgacaccggttcggcggccatcgaaggctgcaagcattgcgagaacgtcgacatt
ttcatcctgcacccgcacaaccgggtttcggaagtgcaacgtcggcagatgacgacgatt
ttcggcgataacatccacaacatcgccatcgaaggcaacttcgatgactgccaggaaatg
gtcaaggccagtttcgccgaccagagcttcctcaagggcacgcggctggtggcggtgaac
tcgatcaactgggcgcggatcatggcccagatcgtttattacttccacgcggccctgcaa
ttgggcggcccggcccgctccgtgtcgttctcggtgccgaccggcaacttcggcgatatc
ttcgccggctacctggcgcgcaacatgggtctgccgatcaatcaattgatcgtcgccacc
aaccgcaacgacatcctgcaccgcttcatgagcggcaaccagtacgtcaaggaaaccctg
cacgccaccctgtcgccgtcgatggatatcatggtgtcgtcgaacttcgaacgcctgctg
ttcgacctgcacggtcgcaatggtgcggcgattgccggcctgatggacagcttccgccag
ggcggcggtttcagcgtcgagcctgagcgctggaccgaagcccgcaagttgttcgactcc
ctggccgtggacgatgagcagacttgcgaaaccatcgccgaggtgttcgagcagagcggt
gagttgctcgatccgcacacggccatcggtgtcagggccgctcgtgagtgccgtcgtagc
ctggacatcccgatggtgatcctgggcacggctcacccggtcaagttcccggaagcagtg
gagaaagccggtgtaggaaaagcgcttgaactacctgcacatctttctgatttgtttgag
cgagatgagcgttgcaccgtgttgcccaacgacttgaaggctgtgcaggcctttgtcagc
cagcatggcaaccgcggcaagccgctctga

DBGET integrated database retrieval system