KEGG   Pseudomonas brassicacearum: PSEBR_c2g32Help
Entry
PSEBR_c2g32       CDS       T01472                                 

Definition
hydrolase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
pba  Pseudomonas brassicacearum
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:pba00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PSEBR_c2g32
Enzymes [BR:pba01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PSEBR_c2g32
   3.1.2  Thioester hydrolases
    3.1.2.-  
     PSEBR_c2g32
Lipid biosynthesis proteins [BR:pba01004]
 Fatty acid synthase
  Component type
   PSEBR_c2g32
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1953222..1953827
Genome map
AA seq 201 aa AA seqDB search
MRVWFLSAGLALMCMAQNAAAGTVLIVGDSISAAFGLDTRQGWVSLLEQRLKAEGFDDKV
VNASISGDTSAGGQARLPALLAAHKPDLVILELGGNDGLRGQPPTQLQQNLAAMIDSARA
SGAQVLLLGMQLPPNYGRRYTDAFARVYSTLAEEKKVPLVPFFLKDVGGIPTMMQGDGLH
PSVAAQGKLLENVWPTLKPLL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtgtggtttttgagtgccggcctggccttgatgtgcatggcccagaacgcagcg
gcgggtacagtcctgatcgttggcgatagtatcagcgcggctttcggcctggatacccgg
caagggtgggtgtcgttgctcgaacaacggctcaaggccgagggttttgacgataaagtg
gtcaatgcttccatcagtggcgacaccagtgccggaggccaggcgcggctgccggcgctg
cttgcagcccataagccggacctggtgatcctggaactgggcggcaacgatggcctgcgc
ggacagccgccaacacaattgcaacaaaaccttgcagcgatgatcgacagcgctcgtgcc
agcggtgcccaggtacttttgctgggcatgcaactgccacccaattacggacggcgctac
accgatgcctttgcccgggtctacagcaccctggccgaggagaaaaaagtcccgctggtg
ccgttttttctcaaggacgtcggtggcatcccgaccatgatgcaaggcgacggattgcac
ccgtccgtcgcggcccagggcaagttgctggaaaatgtctggccgacactgaaaccgctg
ctttga

DBGET integrated database retrieval system