KEGG   Pseudomonas brassicacearum: PSEBR_c2g87Help
Entry
PSEBR_c2g87       CDS       T01472                                 

Definition
oxidoreductase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
pba  Pseudomonas brassicacearum
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:pba00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5088719..5089252)
Genome map
AA seq 177 aa AA seqDB search
MSSLSVYHVSSPDIPNKVLTHVEDIAATLAEQGIHFARWEAAVKIQPGASEEDIIAAYQA
QIDGVMTERGYVAVDVVSVSSDQPEQAGELDECRHSQDEVRFFVAGRGLFNLHVGDYVYA
VLCERNDLITVPAGMPHWFDRGERPHFVTIRLSGDLQGLVAEVTGDDIARRFPRLED
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcctgtcggtctatcacgtttcgagcccagacattccgaacaaagtgttgacc
cacgtcgaggacattgccgcgaccctggctgaacaaggtattcactttgcccgttgggag
gcggcggtgaaaatccagccgggtgccagtgaggaggacatcattgcggcttaccaggct
cagatcgatggggtgatgactgagcggggttatgttgcggtcgatgttgtcagtgtcagc
agcgatcagccggaacaggctggggagctcgatgagtgtcgccatagccaggatgaagtg
cggtttttcgttgccggtcgtggcttgtttaacctgcacgttggggattatgtctacgcg
gtgctgtgtgaaaggaatgacttgataacggtgcctgctggtatgccgcattggtttgac
aggggggagcggccgcatttcgttacgattcgtttgtctggtgatttgcaggggttggtt
gctgaggttacgggggatgatattgctcggcggtttcctcgtctggaagactga

DBGET integrated database retrieval system