KEGG   Plasmodium berghei: PB000126.02.0Help
Entry
PB000126.02.0     CDS       T01111                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
pbe  Plasmodium berghei
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pbe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PB000126.02.0
Enzymes [BR:pbe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     PB000126.02.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 276 aa AA seqDB search
MIYNNIDNNFLQRIEEEEKKKYIGKTVSLNCGLYEFICQLKKYIHEKDISTNTELNFIEK
NIKNNIWRCNIKKNNTETNICSKNVILTVNSKMCANILRKILPIEIKNNLEKISYSSLIT
ANIYFNKEDIKIPKNLFGLLSADKNAYILGCFYASNMFTNRCENNKSLLTLYIRDNNITF
NNNEELNKTILNNLKKIFPFSDNAKPTILNVTKWKHILPAYSENYENKLKEFLNELTNSQ
YENLFVDAGWITGTSISDRITSAMELSDYIIKKNII
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgatatataataatatagataataattttttacaacgcattgaagaagaagaaaaaaaa
aaatatattggaaaaacagtgtcactaaattgtggattatatgaatttatttgtcaacta
aaaaaatatattcatgaaaaagatatatcaacaaataccgaattaaattttatagaaaaa
aatattaaaaataatatatggagatgcaacataaaaaaaaataatactgaaacaaatata
tgtagtaaaaatgttatattaactgttaattctaaaatgtgtgcaaatatattaagaaaa
atattgcctatcgaaataaaaaataatcttgaaaaaatttcatattcatctttaataaca
gcaaatatatattttaataaagaagatataaaaatacctaaaaatttatttggcttattg
tcagctgataaaaatgcatatatacttggctgcttttatgcaagtaatatgtttacaaat
aggtgtgaaaataataaaagtttattaactttatatataagagataataatataactttc
aataacaatgaggaattaaataaaactatattaaacaatttaaaaaaaatatttccattt
agtgataatgcaaaaccaactatattaaatgtaacaaagtggaaacatattttacctgcc
tattcagaaaattatgaaaataaattaaaagaatttctaaatgaattaacaaattcacaa
tatgaaaatttatttgttgatgcaggttggattactggaacttctatatcagaccgaata
acatcagcaatggagttgtctgattatattataaaaaaaaatattatctag

DBGET integrated database retrieval system