KEGG   Plasmodium berghei: PB000150.02.0Help
Entry
PB000150.02.0     CDS       T01111                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
pbe  Plasmodium berghei
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pbe00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PB000150.02.0
Enzymes [BR:pbe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     PB000150.02.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 201 aa AA seqDB search
MKKFSPLVICGPSGVGKGTLIKKLFDEFSNNFRFSISCTTRNKREYEKDGVDYYFINKEE
FEEKIKNKQFLEYDKYANNLYGTLKTEYDQAEKENKICLFEMNINGVKQLKKSEYIKHAI
YIFIKQPNTNVILNRLKKRNTETEEQIKTRMFELTREIEEANTLGFDFFLINDDFEKAYN
DLKNYLMKSYSQLRSEAEKSE
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagtttagtcctttagttatttgtgggccatcaggtgtagggaaaggaaccctg
attaaaaaactatttgatgaattctcaaataattttcgattttctattagttgtacaact
agaaataaaagagaatatgaaaaggatggagtggattattattttataaataaagaagag
tttgaagaaaaaataaaaaataaacaattcttagaatatgataaatatgcaaataattta
tatgggacattaaaaacagaatatgatcaagcagaaaaagaaaataaaatatgcctattc
gaaatgaatataaatggagttaaacaacttaagaaatcagaatatattaagcatgctata
tatatttttataaaacagccaaatactaatgttattttaaacagattgaaaaaaagaaat
acggaaacagaagaacaaataaaaacacgaatgtttgagctaactagggagattgaagaa
gctaatacattgggatttgatttctttctaataaatgatgattttgaaaaagcatataat
gatttaaaaaattacttaatgaagtcttattcacaattgagaagtgaagcagaaaagtct
gaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system