KEGG   Plasmodium berghei: PB000163.02.0Help
Entry
PB000163.02.0     CDS       T01111                                 

Definition
dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pbe  Plasmodium berghei
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pbe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PB000163.02.0
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PB000163.02.0
   00020 Citrate cycle (TCA cycle)
    PB000163.02.0
   00620 Pyruvate metabolism
    PB000163.02.0
Enzymes [BR:pbe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PB000163.02.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 609 aa AA seqDB search
NNYGFINLNNNLRILHKNKHVLYSKVEIKMPALSSTMTSGKIVRWNKTVGEFINVGDIIM
TVESDKADMDVESFDEGLHLCIQVSILSSIHTFLQYKENVDNLPFCTYFFFSGYLRRKII
EEGSEANVGDVLGILTTEENEEVENVDSVKEGTINDETIKEGTINEKATQEGTIDEEAIK
EEGVEKDIYIPSVQSKRNKVRISKWLCKENEFVNKYDVIFHIEDDKSTVEVDSPYTGTIK
TILVKEGELADLEKEVAIILVKKEPNELDTPPINLNSKIKERDVITHFKKKIKDTKEGKQ
FLKTLKSSELDPKSIKGGIQNNQEHGQLHEKIVLPSAIELMKKHKLTPEDITYTSIPNRI
TYEDVDIFLEKKKKIPKIETGPTVETDTRVVKLTNIQKSIKNNMMLTLNVPVFRITHLMK
TSQLIKIYEQVKDKISMSVILNKCVSLALLKNPLIYSTYIDNENGEIRYNKSVNIGNALG
LIDCLLTPVLKNVDQKDIYTLSTEWKDLIKKGKSGTLSANEMSGGNFFISNLGMFNTYQF
DAILPKNVSCILSIGTNIVSINQFDDLKINKGIMMTLTCDHRHIYGSHAATFMNDLANII
ENNIMDIFL
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
aataattatggatttataaacttaaataataatttgagaatacttcacaaaaataaacat
gtcctttattcgaaagttgaaataaaaatgcctgccctatctagtactatgacgagtggc
aaaattgttcgctggaataaaactgttggagaatttatcaatgttggagatataattatg
acagtagaaagtgataaagcagacatggatgttgaatcgtttgatgaaggtttgcatctg
tgcatacaagtttctattctaagttctattcatacatttttgcaatataaagaaaatgta
gacaatttaccgttttgtacatatttttttttctcaggatatttaagaaggaaaataatc
gaagaagggtctgaggcaaatgttggagatgtactaggaattctaacgactgaagaaaat
gaagaagtggaaaatgtagattcggtaaaagaaggaacaataaatgacgaaactataaaa
gaaggaacaataaatgaaaaagctacacaagaaggaacaatagatgaagaagcgataaaa
gaagaaggcgtggaaaaagatatatacattccatcagtgcaaagtaaaagaaataaagta
agaatttccaaatggttatgtaaagaaaacgagtttgtgaataaatatgatgttatattt
cacattgaggacgacaaaagtacagttgaagtggatagcccttatacaggtacaataaaa
acaattttagtgaaagaaggagaacttgcagatttggaaaaagaagttgccataatttta
gttaaaaaggaaccaaatgaactggacaccccccctataaatttaaatagcaaaataaaa
gagcgtgatgtaataacacattttaaaaaaaaaataaaagacactaaagaagggaaacaa
tttttaaaaacattaaaatcttctgaattggacccaaaaagcatcaaggggggtatacag
aacaaccaagaacatggacaattgcatgaaaaaatagtattgccatctgccattgaactt
atgaagaagcataaactaactcccgaagatatcacatacacgagcataccgaacagaatc
acttacgaagatgtcgacatatttctcgaaaaaaaaaaaaaaattccaaaaatagaaact
ggtccaacagtagaaaccgatacaagagtggtaaaactaacgaatatacaaaagtctata
aaaaataatatgatgctaacattaaacgttccagtatttcgaataacacatttaatgaaa
acttctcaattaataaaaatatatgaacaagtaaaagataaaataagtatgtcagtcata
ttaaataaatgtgtatctttggctttacttaaaaatccattaatatattcaacatatata
gataatgaaaatggagaaattcgatataataaaagtgtaaatataggaaacgcattaggg
ctcattgactgtttattaacgcctgttttaaaaaatgtcgatcaaaaagatatatataca
ttgtcaacagaatggaaagatctgataaaaaaaggaaaaagtggaaccctttcagcaaat
gaaatgtctggaggtaatttttttatttcgaatttaggaatgtttaacacatatcagttt
gatgctattttgccaaaaaacgtatcatgtattttatcaattggtacaaatatagttagt
ataaatcagtttgacgatttaaaaataaataaaggaataatgatgactttaacatgtgat
catagacatatatatggttcccatgctgctacatttatgaatgatttagcaaatatcatt
gaaaataatatcatggatatatttttataa

DBGET integrated database retrieval system