KEGG   Plasmodium berghei: PB000330.03.0Help
Entry
PB000330.03.0     CDS       T01111                                 

Definition
protein disulfide isomerase related protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
pbe  Plasmodium berghei
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:pbe04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 423 aa AA seqDB search
MKLYGKIHFILPVLYLFAKYASSLYTNVKEIKTVESLNEFDELINSQKKCLVQFYATWCR
VSRGFSNDFINIAKTVKDDILVIAIKNEDIINKYKIKTYPNIQLFFTNDKKEKHIEQFDG
NYKIKDVVSFIYDNIKNYRLKELNIDVGKKDNSNKKNKKNKNSGKVIVLNDSNFDQNVLK
NDDNVWFVFFYAPWCGHSKPIHPMFDELAKKTSHLKNARIAKIDATVEQRTAQTYEIKHY
PSFRLFPSGNKKPHTAIDYNESRTVNDLYQFFLKYYKEKKEIIQLTSRNVFDEHCENDVC
LLAILPSKEDIEPSSLKSYIQILTSVIKDVNHLPVTLMWTHAGDQLDIVQKLNLTFGFPT
VIAISFSKNVYSILKGNYSEQSIKNFVIQMMTGKSSVDNLVPFNVNNVPKVDLNNMNEYN
SEL
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaaactatatggaaaaatacacttcatattacctgtactttacctttttgcaaaatat
gcaagtagcttatatacaaacgtaaaagaaattaaaacagtagaatcccttaacgaattt
gatgaattgataaattctcaaaaaaaatgcttagttcaattttatgctacatggtgtcga
gtttccagagggttctctaacgattttataaatatagcaaaaacagtcaaagatgatata
ttagttatagctataaaaaatgaagatataataaataaatataaaattaaaacttatcca
aatatacaactattttttaccaatgataaaaaagaaaagcatattgaacaatttgatgga
aattataaaataaaagatgttgtttcatttatatatgataatattaaaaattaccgttta
aaagagttaaatattgatgttggtaaaaaggataattcaaataaaaaaaataaaaaaaat
aaaaatagtggtaaagtaattgtattaaacgattctaactttgatcaaaatgttttaaaa
aatgatgataatgtatggtttgtttttttctatgccccatggtgtgggcatagtaaacct
attcatccaatgtttgatgaactagctaaaaaaacctcgcatttaaaaaatgcaagaata
gcaaaaattgatgcaaccgttgaacaaagaacagcacaaacttatgaaataaagcattac
ccttctttccgtttatttccatcaggaaataaaaaaccacacactgctatagattataat
gagtctagaactgttaatgatctttatcaattttttttaaaatattataaagaaaaaaaa
gaaataatacaattaacatctcgaaatgtttttgatgaacattgtgaaaatgatgtttgc
cttttagctatattaccaagtaaagaagatattgaaccaagttctttaaaatcttatatt
caaatattaactagtgtaataaaagatgttaatcatcttcctgttactctaatgtggaca
catgctggagatcaattagatatagttcaaaaattaaatttaacatttggatttccaact
gttattgctattagtttttcaaaaaatgtttattcaattttaaaaggaaattattctgaa
caatcaatcaaaaattttgttatacaaatgatgacaggaaaatcatcagttgacaatttg
gttccatttaatgttaataatgtaccaaaagttgatctcaataatatgaatgaatacaat
tcagaattataa

DBGET integrated database retrieval system