KEGG   Plasmodium berghei: PB000393.03.0Help
Entry
PB000393.03.0     CDS       T01111                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
pbe  Plasmodium berghei
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PB000393.03.0
Enzymes [BR:pbe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     PB000393.03.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 453 aa AA seqDB search
MKKFMNIIFFLCVCATYVSSQADQIINERLDKFVFLSCNNHKKKPNTNLIKSIEKKKPQL
MLWIGDYFYSECRELKCLKEAYEYIKKDKYYINIKKKFTIDGIYDDHDYNCNNGDRLYKY
KKESKTMYLDYLGVDKNDIRYKRNGAYFSKLYIDPNDENNQVKIIILDTRYNKDPYPYYS
IESHNDHFISLALSLLSRVHASLFGFYCNSNNDILGNEQWKWLEKEFTNSKARAHIVISS
IQVFANFIINENWGLMPAALKRLKALIKKTKPKGLVFLSGDVHYGSIIGNEEDIIEVTSS
NVNQENIFSPIINYFAYYISYLLNKKTPFIFDKIYGFSNYGEINITYPDKNKINLKISIN
SSNGEEVISANQSFNNQKDIYVKTKDIHLINDDFACLSCKSKSKVFMIFIAYILYILWCL
QIFFIILKIIIHKKGAKEIHNSNKEDAVQKKNK
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagtttatgaatataattttttttttgtgtgtgtgtgcaacatatgtgagttcc
caggcagatcaaataattaacgaacgattagacaagtttgtttttttaagttgtaacaat
cataaaaagaaacccaacaccaatttaataaaatccattgaaaaaaaaaaaccacaattg
atgttatggataggagattatttttattcagaatgtagagaacttaaatgtctaaaagaa
gcatatgaatatattaaaaaagataaatattatataaatataaaaaaaaaattcacgatt
gatggaatttatgatgatcatgattataattgtaataatggagaccgtttatataaatat
aaaaaagaaagtaaaactatgtatttagattatttaggtgtcgataaaaatgatataaga
tacaaaagaaatggagcatatttttctaaattatatatagatccaaatgatgaaaataat
caagttaaaattattattttagatacaagatataataaagatccttatccatattattcc
attgaatcacataatgatcattttattagtttggctctatccttattatctcgtgtgcat
gcatcattatttggattttattgtaatagtaacaatgatatactaggaaatgaacaatgg
aaatggttggaaaaagaatttactaattctaaagctcgtgctcacatcgttatatcatct
atacaggttttcgccaattttataataaacgaaaattgggggttgatgcctgcagcctta
aagagactaaaggcattaataaaaaaaacaaaaccaaaaggattagtatttttaagtggt
gatgtacattatggtagtataattggaaatgaggaagatatcattgaggtaacaagtagc
aatgtaaatcaggaaaatatatttagccctattattaattattttgcttattatatttca
tatttattaaataaaaaaacaccttttatattcgacaaaatatacggatttagtaattat
ggtgaaattaatattacttatccagataaaaataaaataaatcttaaaatttctataaat
agttcaaatggcgaagaagttatatcagctaatcaatcttttaataatcaaaaagatata
tatgtcaaaacaaaagatattcatttaataaatgatgattttgcatgtttatcatgtaaa
agcaaatcaaaagtatttatgatttttattgcttatatattatatatattatggtgcctt
caaatttttttcattattttaaaaattattatccataaaaaaggtgcaaaagagatacat
aatagtaataaggaagatgccgtgcaaaaaaaaaataaataa

DBGET integrated database retrieval system