KEGG   Plasmodium berghei: PB000407.00.0Help
Entry
PB000407.00.0     CDS       T01111                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
pbe  Plasmodium berghei
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:pbe00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    PB000407.00.0
  Replication and repair
   03420 Nucleotide excision repair
    PB000407.00.0
Transcription machinery [BR:pbe03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     PB000407.00.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 929 aa AA seqDB search
MVKARKNIENMEIYDYMKEMDEKVWEYLFDDSLAHETIFSSLNELEQIIISRLLFIQQVV
SERAMRLWINPNFLKKLSESIKNLVDVKILVESETKKDNYNQYKINDRFRLTLLNKIYQN
DKNNICIFNNNIKLQLSKENELYEKKLFPTKEGILCYANTRWNTLLHFIASPNLNSYKYS
HSYSGSYASTYPQCSSIHGGIESPIKTEVGTSLDVNNIHSYGGEYSYNNSLKSVKMEKGN
YYGIQTKKSKKNNEGSDEEYQPYGDEMYDDENYGNESFSQRRKYKNYGEYENMGNNSEYD
EDETNEQYDNSLYPQDKEIRNKYSQNYNDIENSNSGKYLNTRMGNKENVNLYDPNKKIDG
RRGRKKKKGVYAYKQNNLYYKSLQSRENNNMEEENNDFFFSSSNIKKEDLLTCAPCGSLI
EVLKKKKFILDDINNSANIANNNSNNKTINMSREAFSWFLKDIRSRIISLVIEYLLIIDD
GNVTNIAKQNSAKYKKKNNSENVISSDGNEALENSSITNTLINDFNNNDNMNNNNNNNNN
MNGGEWDTNNEDMNNADGVNINIKDTHDYITDPNKNSQKSEIYVKETLLLILSLTQCNIG
QPIFLENLTKAQKEFVDFGIHIGLFLKTHDSYIFITPYALLLTINNLNVENYISILNHLS
VEKFCEESGYNNNDDENIKKKAKLSEIYFHKYLLLQNTARVKNEPLIDEDEKKKLKKIET
KNFISQDITNHNIHSEKRLNENDNLEIGLIIQSNFKVYLYTSSILKINILSHLCELQART
PNMVVGILTRRSVLNAYNSDITADQIIKFLESYSHPGKTKLKSIIPINVITQLKLWEAER
HRLILEDSIVFKNFEKEYLPHLYQQIVIWANSKNYLLHYTPWPKNTNSTEFDTWMKAEKY
LCCIYESKNEIIDKIKEIRGKLMKKRQAI
NT seq 2790 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggcacgaaagaatattgagaatatggaaatatatgattacatgaaggagatg
gatgaaaaagtatgggaatatttgtttgatgattcactagcacatgaaacgatatttagc
tcactaaatgaattagagcaaattataatatctaggctattgtttattcaacaagtagtt
tcagaaagagctatgagattgtggataaatccaaactttttgaaaaaattaagtgaaagt
ataaaaaatttagttgatgttaaaatattagttgaaagtgaaacaaaaaaagataactat
aaccaatataaaataaatgatcgattcagattaacattattaaataaaatatatcagaat
gataaaaataatatttgtatatttaataataatataaaactacaactaagtaaagaaaat
gaattatatgaaaaaaaattatttcctacaaaagaaggtattctatgttatgctaataca
cgatggaatactctcttacattttattgcttcaccaaatttgaatagttataaatatagc
catagttatagtggtagttatgctagtacatacccacaatgtagcagcattcatggtggt
atagaatcacctattaaaacggaggtgggtacctctctcgatgtaaataatattcattct
tatggaggagagtattcttataataacagtttgaaaagtgtaaaaatggaaaaaggaaac
tattatggtattcaaactaaaaaaagcaaaaaaaataatgaaggtagtgatgaagaatat
caaccttatggtgatgaaatgtatgatgatgaaaattatggaaacgaatcattttcacaa
agaaggaaatataaaaattatggagaatatgaaaacatgggaaataattcagaatatgat
gaagatgaaacaaatgagcaatatgacaattcactatacccacaagataaagaaatccga
aataaatattcacagaattataatgacattgaaaatagtaatagtggtaaatatttaaac
acaagaatgggtaataaagaaaatgtaaatttatacgatccgaataaaaaaatagacgga
agacgaggaagaaaaaaaaaaaaaggcgtatatgcatataaacaaaataatttatattat
aaaagtcttcaaagtagagaaaataataatatggaagaagaaaataatgatttttttttt
tcttcatcaaatattaaaaaagaagatttgttaacatgtgcaccatgtggtagtttgata
gaagttttgaaaaaaaagaaatttatacttgatgatataaataatagtgctaatattgct
aataataatagtaataataaaacgataaatatgagtagggaagcattttcatggttttta
aaagatatacgaagtagaataatatctctagttattgaatatttgctgataatcgatgat
ggaaatgtaacaaatatagctaagcaaaattcagctaaatataaaaaaaaaaacaattca
gaaaatgtgatttctagtgatggaaatgaagctttagaaaatagttccatcacaaatact
cttataaatgattttaacaataatgataatatgaataataataataataataataataat
atgaacggaggggaatgggatactaacaatgaagatatgaataatgcagatggtgtaaat
ataaacataaaagatacacacgattatataacagatccaaataaaaattctcaaaaatcc
gagatatatgtaaaagaaacattattattaattttatcactaacccaatgtaatattggt
caaccaatatttttagaaaacttaacaaaagctcaaaaagaatttgtagattttggtata
catatagggttatttttaaaaacacatgatagttatatatttataacaccatatgcatta
ttattaacaataaataatttaaatgttgaaaattatatatctatattaaatcatctatct
gtagaaaaattttgtgaagaatctggttataataataatgatgatgaaaatataaaaaaa
aaagcaaaattaagtgaaatatattttcataaatatttattattacaaaatacggcccgt
gtgaaaaatgagccactaatagatgaggacgagaaaaaaaaattgaaaaaaattgaaaca
aaaaattttatttcgcaagacataactaatcacaatatacattcagaaaaaaggttaaat
gaaaatgataatttagaaatcgggttaatcattcaaagtaattttaaagtttatttgtat
acttcgtcaattttaaaaataaatattttaagccatttatgtgaattacaagcaagaaca
ccaaatatggttgttggtatattaacaagaagaagcgtactaaatgcatataactcagat
attaccgctgatcaaattattaaatttttagaatcttattcacatcctggaaaaacaaaa
ttaaaaagtataataccaattaatgttattactcagcttaaattatgggaagctgaaaga
catcgattaatattagaagattctattgtttttaaaaatttcgaaaaagaatatttacca
catttatatcaacaaattgttatttgggctaatagcaaaaattatttattacattatacc
ccatggccaaaaaacactaattccactgaatttgatacatggatgaaagcagaaaaatat
ttatgttgtatatatgagtctaaaaatgaaattattgataagataaaggaaattcgtggt
aagttgatgaaaaaacgtcaggcaatatga

DBGET integrated database retrieval system