KEGG   Plasmodium berghei: PB000428.00.0Help
Entry
PB000428.00.0     CDS       T01111                                 

Definition
hypothetical protein
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
pbe  Plasmodium berghei
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 356 aa AA seqDB search
MEEIEYVLSRETVMQVVNETLNNRYEKEEECYYSFHKKYDVVYLCSDLKNDGNLLICDKP
ENGENGKIVKFEENNPEYVMNMIDAKKKIIVEQTKNKKGRRRSNSDSGQGSNKGDSNEED
SEYLYYYYLFGLATTYTFFTFQFDRNRISQFLIFPPMQNKGLGMKVLEKIYHLSIVNSNI
KEITVEDPAASFTHLRDIITIKICIDLKILSPTILYPDEYLKTKNIEKEHVELDKKKFIK
VCKETHKQITRMIETISLAGVLPYPAPLYIENEDKHVHFRKKEKNENVNIANSMEHFEAS
DACKDVRIKIKKRIKSDYIGNLINKNTNCMSSDVFRDYVKEELNNLWKKQCKVYYR
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaatagaatatgtacttagccgtgaaacagttatgcaagttgttaatgagacg
ttgaataatagatatgaaaaagaggaagaatgttattactcttttcataaaaaatatgat
gttgtttatttatgttcagatttaaagaatgatggaaatttattaatttgtgacaaacct
gaaaatggcgaaaatggtaaaatagtaaaattcgaagaaaataatccagaatatgtaatg
aatatgattgatgcaaaaaaaaaaataatagtagagcaaacaaaaaataaaaaaggaaga
agacgaagtaatagtgatagtggacaaggaagtaacaaaggtgatagtaatgaagaagat
tcagaatatttatattattattatttatttggattagcaacaacatatacattttttact
tttcaatttgatagaaatcgaatatcacaattcttgatttttccacctatgcaaaataaa
ggattaggaatgaaagtattggaaaaaatttatcatttatcgattgtcaattctaacata
aaagaaattactgtagaagatccagcagcatcttttacacatttaagagacatcataaca
ataaaaatatgtattgatttgaaaattttaagtccaactatattatatcctgatgagtat
ttaaagacaaagaatatcgaaaaagaacatgtagaattagataaaaaaaaatttataaaa
gtctgtaaagaaactcataaacagattacacgaatgattgaaacaatatctttagctggt
gttttaccttaccctgctcctttatatattgaaaatgaagataagcatgttcattttcga
aaaaaagagaaaaatgaaaatgtgaatatagcaaactcaatggagcatttcgaagcttca
gatgcatgtaaagatgtccgaataaaaattaaaaaacggataaaaagtgattacattgga
aatcttataaacaaaaataccaactgtatgtctagtgatgttttccgagattatgtaaag
gaagagctaaataatttgtggaagaaacagtgtaaagtatattacaggtaa

DBGET integrated database retrieval system