KEGG   Plasmodium berghei: PB000494.02.0Help
Entry
PB000494.02.0     CDS       T01111                                 

Definition
biotin carboxylase subunit of acetyl CoA carboxylase
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
pbe  Plasmodium berghei
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:pbe00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PB000494.02.0
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PB000494.02.0
   00640 Propanoate metabolism
    PB000494.02.0
  Lipid metabolism
   00061 Fatty acid biosynthesis
    PB000494.02.0
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    PB000494.02.0
Enzymes [BR:pbe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     PB000494.02.0
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     PB000494.02.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 980 aa AA seqDB search
FMSELKESIEDISIYRLNPSIQDIKISSNIIYHIVLPNNSNIEDHVNEIKEIYKNFLNKY
NELFIENYVNNVYIKVYKEIKEETNNETKLELNQLLKLHVLFDNEKEVIEKVDKINPVII
DALHLKRKRARDVDTIYAYDFVKLINISLNRINNTLNDNFNYINSVKEFKIDYSRENSEE
INDAVSAGKKEKSQPNKNDKQSKWLFENFGNLSSDEIRIKKSLYLSNSLEIGQNKMSVIG
LLMNVKTDEYKEGRDIAFIINDITTNGGAFSVLEDELFYGVSCYAREKKIPRIYISCNSG
AKIGLYNYLMDKIKVCWNDENKKELGYKYIYITEEIKETIPKKDIIYLREIYENGEKRYI
IDAIVGNLNNHIGVENLRGSGLIAGETSKAYDEIFTLSYVTGRSVGIGAYLVRLGKRTIQ
KKGSSLLLTGFNALNKILGEKVYISNEQLGGVNIMMKNGISQLEAENDQDGVNKIFKWLS
YVPKTSDSYFYALGESTKSFHNKFQENSKCDISKSRNLNNSIGSDQESNNYPTGYTNDRG
IQEYVKKNSLHSSSDSTTVEPESIKECDTSLMHTNEKNGDEESGNEISDIIPDNWNKIND
VDMENVNEADIIELLKGSDKKQGFLDKNSYFEYMNEWGKGIITGRGKLGSIPIGFIAVNK
NLVTQTVPCDPALKTKAIKTTNAPCVFVPDNSYKTAQSIEDFNKENLPLFVFANWRGFSG
GTMDMFNSILKFGSMIVNQLVNYKHPVFVYIPIFGELRGGSWVVVDETLNSQIIEMYADN
NSKGGILEPPGLVEVKFKFAEIKKLMNNSDPYIIELNQKLATLQNEEEILSVKKEIEKKE
KEMLPFYLQVCHKYADLHDVSLCMKEKGVIRKIVPWEKSRSFFYYRLLRRLILHTLNKKF
GDSYANCDEIKDIINGLKNSESDDQIVCKSVLTGNVLKNINKIKDEILHKKTLDGIFKEF
QNLSKTQKMELYKKISSYEF
NT seq 2943 nt NT seq  +upstreamnt  +downstreamnt
tttatgtctgaattaaaagaatctatagaagatataagcatttatagattaaatccatca
attcaggatattaaaattagtagcaatataatatatcatatagtattgcctaataattca
aatatagaagatcatgtaaatgaaattaaagaaatttataaaaattttctcaataaatat
aatgaacttttcatagaaaactatgttaataatgtatatattaaagtatataaagaaatt
aaagaagaaacaaataatgaaacaaaattagagcttaaccaattgttgaaattgcatgtt
ctttttgataatgaaaaagaggttattgaaaaagtggataaaataaatccagttattatc
gatgcattgcacttaaaacgaaagagagcaagggatgtagatactatatatgcttatgat
tttgttaagcttataaacatatcattaaataggataaataatactttgaatgacaatttt
aattatattaatagtgtgaaagaattcaagatagattatagtagggaaaactccgaagaa
ataaatgatgcagtaagtgcgggaaagaaagaaaaatctcaacctaataaaaatgataaa
caatctaaatggctttttgaaaattttggcaatttaagtagtgatgaaattcgaataaaa
aaatcactttatctatcaaactctttggaaataggacaaaataaaatgagtgtaatcgga
ctgttaatgaatgtaaagacagatgaatataaagaaggaagagatattgcttttataata
aatgatattacaaccaatggaggtgcatttagtgttttagaagacgaactattttatgga
gtatcatgctatgcgagagaaaaaaaaataccacgcatatacatatcttgcaattccggg
gctaaaattggattatataattatcttatggataaaattaaagtatgctggaatgatgaa
aataaaaaagaacttggatataagtatatatatataacagaagaaataaaagaaacaatt
cctaaaaaagatattatttatttaagagaaatttatgaaaatggagaaaaaagatatata
attgatgctatagtaggaaatttaaataatcatataggggtagaaaatttaagaggtagt
gggttaatagcaggagaaacctcaaaggcttatgatgagatttttactctttcatatgtc
actggaagaagcgttggaattggtgcttatttagttagattaggtaaacgaactattcaa
aaaaaaggatcctctcttttattaactggttttaatgctttaaataaaatattaggtgaa
aaagtatatataagtaatgagcaattaggaggtgtaaatattatgatgaaaaatggaata
tctcaattagaagctgaaaatgaccaggatggagtaaataaaattttcaaatggttatca
tatgttcctaaaactagtgacagttatttttatgctcttggggaatcaacaaaatcattt
cataataaatttcaagaaaatagcaaatgtgatattagcaaatctagaaacttaaacaat
tcaattggttctgatcaagaatccaataattatccaacgggatacactaatgatcgaggc
atacaagagtatgtaaaaaagaacagtttacacagcagttcagatagtactactgttgaa
ccagaaagtatcaaagaatgtgatacttcacttatgcacaccaatgaaaaaaatggtgat
gaagaatcagggaacgaaattagtgacatcattccagataactggaacaaaataaatgat
gtagatatggaaaatgtaaatgaagcagatatcatcgaattactaaaagggtcagataaa
aaacaaggatttttagataaaaatagttactttgaatatatgaatgaatggggaaaaggt
attataactggaagaggaaaattaggatcaataccaattggttttattgctgtaaataaa
aatttagttacccaaacggttccatgtgatccagcattgaaaactaaagctataaaaaca
acaaatgccccatgtgtttttgtgcctgataattcgtataaaactgcgcaatctattgaa
gattttaataaagaaaatctacctttatttgtatttgcaaattggagaggtttttcagga
ggtactatggatatgtttaacagtatcttaaaatttggatcaatgatagttaatcaatta
gttaattataagcatcccgtttttgtatacatacctatttttggagaacttagaggtgga
tcttgggtagtagtagatgaaacattgaacagccaaataatagaaatgtatgcagataat
aatagtaaaggtggaatattagaacctccaggattagtagaagtcaaatttaagttcgca
gaaattaagaaattaatgaataacagtgatccatatataatagaactaaatcagaagctc
gcgactcttcagaatgaagaagaaattttaagtgtaaaaaaggaaatagaaaagaaggaa
aaggaaatgcttccattttatttacaagtatgtcataaatatgcagatctacatgatgta
tccttatgtatgaaggagaaaggtgttattagaaaaattgttccatgggaaaaatctaga
tcctttttctattaccgcttattaaggagattgatattacatacattaaacaaaaagttt
ggagattcttatgccaattgtgatgaaattaaggatattatcaacggccttaaaaattct
gaaagtgatgaccaaattgtatgcaaaagcgttttaactggaaatgttttaaaaaatata
aacaagataaaagatgaaattttacataaaaaaactttagatggtattttcaaagaattc
caaaatttatcaaaaacacaaaaaatggaactttataaaaaaattagttcttatgaattt
taa

DBGET integrated database retrieval system